Recombinant Mouse NEDD4 family-interacting protein 1 (Ndfip1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized preparation.
Lead Time
Delivery times vary by purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Specify your required tag type for preferential development.
Synonyms
Ndfip1; N4wbp5; NEDD4 family-interacting protein 1; NEDD4 WW domain-binding protein 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-221
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Ndfip1
Target Protein Sequence
MALALAALAAVEPACGSGYQQLQNEEEPGEPEQTAGDAPPPYSSITAESAAYFDYKDESG FPKPPSYNVATTLPSYDEAERTKTEATIPLVPGRDEDFVGRDDFDDTDQLRIGNDGIFML TFFMAFLFNWIGFFLSFCLTTSAAGRYGAISGFGLSLIKWILIVRFSTYFPGYFDGQYWL WWVFLVLGFLLFLRGFINYAKVRKMPETFSNLPRTRVLFIY
Uniprot No.

Target Background

Function

Recombinant Mouse NEDD4 family-interacting protein 1 (Ndfip1) activates HECT domain-containing E3 ubiquitin-protein ligases, including NEDD4 and ITCH, modulating the stability of their target proteins and influencing numerous cellular processes. Its functions include:

  • Regulation of Immune Responses: Prevents chronic T-helper cell-mediated inflammation; restricts proinflammatory cytokine production in effector Th17 T-cells; limits cytokine signaling and expansion of effector Th2 T-cells; regulates peripheral T-cell tolerance.
  • Metabolic Regulation: Promotes pancreatic beta cell death, reducing insulin secretion; influences glucose metabolism.
  • Antiviral Response: Negatively regulates RLR-mediated antiviral responses.
  • Ion Channel Modulation: Negatively regulates KCNH2 potassium channel activity.
  • Neuroprotection: Mediates the ubiquitination of SLC11A2/DMT1, protecting cortical neurons from cobalt and iron toxicity; important for normal dendrite and dendritic spine development.
  • Cellular Signaling: Enhances BRAT1 ubiquitination; enhances ITCH-mediated ubiquitination of MAP3K7; modulates EGFR signaling by regulating the AKT1-to-MAPK8 signaling ratio; inhibits cell proliferation by promoting PTEN nuclear localization.
Gene References Into Functions

Supporting Research: The following publications provide evidence for Ndfip1's diverse functions:

Database Links
Subcellular Location
Endosome membrane; Multi-pass membrane protein. Golgi apparatus membrane. Cell junction, synapse, synaptosome. Cell projection, dendrite. Secreted.
Tissue Specificity
Highly expressed in embryonic and early postnatal cortex (at protein level). Widely expressed. Hardly detectable in resting T-cells; up-regulated in T-cells in response to activation.

Q&A

What is the basic structure and function of Ndfip1?

Ndfip1 belongs to a small group of evolutionarily conserved proteins characterized by three transmembrane domains. It functions primarily as an adapter for ubiquitin ligases, particularly those in the Nedd4 family. The protein contains N-terminal cytoplasmic PY motifs that bind and activate Itch and Nedd4, facilitating protein ubiquitination and subsequent degradation . This regulatory mechanism is critical for controlling protein turnover in various cellular contexts, including immune cell function and neuronal signaling pathways.

How does Ndfip1 interact with the ubiquitination machinery?

Ndfip1 serves as an adaptor protein that recruits and activates E3 ubiquitin ligases of the Nedd4 family. During spatial learning, co-immunoprecipitation experiments have demonstrated that training decreases the association between Ndfip1 and the E3 ubiquitin ligase Nedd4 (Nedd4-1) . This dissociation leads to reduced ubiquitination of target proteins such as Beclin 1 and PTEN, which have been identified as endogenous ubiquitination targets of Nedd4 in the hippocampus . Mechanistically, Ndfip1 binding to Nedd4 family ligases induces a conformational change that releases these enzymes from their auto-inhibited state, allowing them to ubiquitinate their substrates.

What are the major experimental models used to study Ndfip1 function?

Multiple experimental models have been developed to study Ndfip1 function:

Model TypeDescriptionKey Applications
Ndfip1-YFP reporter miceExpress yellow fluorescent protein fused to Ndfip1Tracking Ndfip1 expression patterns in vivo
Ndfip1-deficient mouse strainsVarious knockout strains including complete and conditional knockoutsStudying physiological roles and disease mechanisms
Ndfip1 conditional heterozygous (cHet) micePartial reduction of Ndfip1 expressionInvestigating dose-dependent effects
Mixed bone marrow chimerasMixture of wild-type and Ndfip1-deficient cellsDistinguishing cell-autonomous from non-cell-autonomous effects

These models have revealed that Ndfip1 deficiency leads to cell-autonomous effects in CD4+ T cells, including increased frequencies of CD44hi, IFN-γ+, and IL-4+ cells, demonstrating Ndfip1's critical role in T-cell tolerance .

How does Ndfip1 regulate T-cell tolerance to self and exogenous antigens?

Ndfip1 functions as a critical mediator of peripheral T-cell tolerance through several mechanisms:

  • Cell cycle regulation: Ndfip1 is progressively induced during T-cell differentiation and activation, acting within dividing helper T cells to force their exit from the cell cycle after 1-5 divisions when responding to innocuous self or exogenous antigens . This prevents extensive proliferation that would otherwise lead to effector differentiation.

  • Suppression of effector differentiation: Ndfip1 deficiency results in a marked increase in differentiation of CD4+ T cells into Th2 effector cells. This occurs partly through Ndfip1's role in ubiquitination and degradation of JunB, an IL4 gene transcription factor preferentially expressed in Th2 cells .

  • Forkhead box P3-independent mechanism: Importantly, Ndfip1 operates through a Foxp3-independent mechanism of peripheral tolerance, distinct from regulatory T cell-mediated suppression .

These mechanisms collectively prevent the accumulation of self-reactive T cells and dampen inappropriate responses to exogenous antigens that should be tolerated.

What pathological conditions result from Ndfip1 deficiency in the immune system?

Ndfip1 deficiency leads to several pathological conditions:

ConditionCharacteristicsUnderlying Mechanism
DermatitisInflammatory skin conditionExcessive Th2 responses
Autoimmune pancreatic destructionPancreatic inflammation and damageAccumulation of non-tolerant anti-self T cells
DiabetesImpaired glucose metabolismRequires strong stimulation by exogenous tolerogen
Systemic inflammationMulti-organ inflammatory changesFailure of peripheral T-cell tolerance

These conditions demonstrate that Ndfip1 deficiency precipitates a failure in peripheral tolerance, allowing autoreactive T cells to expand and cause tissue damage . Significantly, these pathologies are lymphocyte-dependent, as Rag1−/− Ndfip1kru/kru mice (lacking T and B cells) do not develop dermatitis or premature mortality observed in lymphocyte-sufficient Ndfip1kru/kru mice .

How do researchers distinguish between cell-autonomous and non-cell-autonomous effects of Ndfip1 deficiency?

Researchers employ mixed bone marrow chimera experiments to distinguish between cell-autonomous and non-cell-autonomous effects of Ndfip1 deficiency. In these experiments:

This experimental approach has been crucial in establishing that Ndfip1 has a direct, cell-autonomous requirement in CD4+ T cells for maintaining peripheral tolerance.

What role does Ndfip1 play in spatial memory formation?

Ndfip1 functions as a negative regulator of spatial memory formation. Research using differential display-polymerase chain reaction has revealed several key aspects of this role:

  • Expression patterns: Fast learners in water maze tasks show decreased Ndfip1 mRNA and protein expression levels compared to slow learners. Similarly, spatial training decreases Ndfip1 mRNA and protein expression levels .

  • Performance enhancement: Ndfip1 conditional heterozygous (cHet) mice exhibit enhanced spatial memory performance compared to control mice, confirming Ndfip1's inhibitory role in memory formation .

  • Molecular mechanism: Spatial training decreases the association between Ndfip1 and the E3 ubiquitin ligase Nedd4, leading to:

    • Decreased ubiquitination of Beclin 1 and PTEN

    • Increased expression of Beclin 1 and PTEN proteins in the hippocampus

  • Functional significance: Becn1 conditional knockout and Pten conditional knockout mice both show impaired spatial learning and memory performance, confirming these proteins' importance in memory formation .

This evidence establishes Ndfip1 as a significant molecular brake on spatial memory formation, acting through regulation of protein ubiquitination in the hippocampus.

How does Ndfip1 regulation of Beclin 1 and PTEN affect neuroplasticity?

Ndfip1 regulates neuroplasticity through its effects on Beclin 1 and PTEN ubiquitination:

  • Ubiquitination control: Ndfip1 facilitates Nedd4-mediated ubiquitination of both Beclin 1 and PTEN, targeting them for degradation. During spatial learning, dissociation of Ndfip1 from Nedd4 decreases this ubiquitination .

  • Protein stability: Reduced ubiquitination leads to increased stability and expression of both Beclin 1 and PTEN proteins. Accordingly, Ndfip1 cHet mice show higher expression levels of Beclin 1 and PTEN compared to control mice .

  • Functional consequences:

    • Beclin 1 is essential for autophagy, a process critical for synaptic plasticity and memory formation

    • PTEN regulates PI3K/Akt signaling, which influences synaptic strength and neuronal morphology

    • Both proteins contribute to the structural and functional changes underlying memory formation

This mechanism represents a novel pathway by which cognitive processes regulate protein stability and function in neurons, highlighting the importance of ubiquitination in neuroplasticity.

What techniques are most effective for studying Ndfip1 protein interactions?

Several techniques have proven particularly effective for studying Ndfip1 protein interactions:

TechniqueApplicationKey Insights
Co-immunoprecipitationDetecting protein-protein interactionsRevealed dynamic association between Ndfip1 and Nedd4 during spatial learning
Western blottingQuantifying protein expressionConfirmed absence of ~27-kDa wild-type Ndfip1 protein in mutant mice
Ubiquitination assaysMeasuring ubiquitination levelsDemonstrated decreased Beclin 1 and PTEN ubiquitination during spatial training
Yeast two-hybrid screeningIdentifying novel interaction partnersHelped establish Ndfip1 as an adaptor for Nedd4 family proteins
Structure-function analysisMapping interaction domainsIdentified N-terminal cytoplasmic PY motifs that bind and activate Itch and Nedd4

For optimal results when studying Ndfip1 interactions, researchers should consider combining multiple approaches. For instance, initial identification of interaction partners via co-immunoprecipitation can be followed by functional validation using ubiquitination assays and in vivo models to establish physiological relevance.

How should researchers design experiments to study Ndfip1's role in T-cell tolerance?

Designing experiments to study Ndfip1's role in T-cell tolerance requires careful consideration of several factors:

  • Experimental models:

    • Use Ndfip1-YFP reporter mice to track Ndfip1 expression during T-cell differentiation and activation

    • Compare Ndfip1-deficient and wild-type T cells responding to tolerogenic stimuli

    • Employ mixed bone marrow chimeras to distinguish cell-autonomous effects

  • Stimulation protocols:

    • Use antigen exposure without adjuvant to study tolerance induction

    • Compare responses to innocuous foreign antigens versus self-antigens

    • Track cell division using CFSE labeling to monitor proliferative responses

  • Analysis parameters:

    • Measure cell division numbers before arrest (1-5 divisions in normal tolerance)

    • Assess effector differentiation, particularly Th2 development

    • Evaluate cytokine production (especially IL-4 and IFN-γ)

    • Examine expression of activation markers like CD44

  • Controls:

    • Include Foxp3-deficient models to distinguish from regulatory T cell effects

    • Use JunB transgenic mice to differentiate from simple JunB overexpression effects

    • Compare with other anergy or tolerance models to establish specificity

This comprehensive approach allows researchers to dissect the specific contribution of Ndfip1 to peripheral T-cell tolerance and distinguish it from other tolerance mechanisms.

How do researchers resolve apparent contradictions in Ndfip1 functional data?

Resolving contradictions in Ndfip1 functional data requires systematic analysis and consideration of several factors:

  • Model-specific differences: Different knockout strategies may result in varying phenotypes. For example, the Ndfip1kru/kru mouse model produces a truncated protein with residual activity that differs from complete knockouts . When contradictions arise, researchers should carefully compare:

    • The exact nature of the genetic modification

    • The presence of potential residual protein products

    • The developmental timing of gene inactivation

  • Context-dependent functions: Ndfip1 may have distinct roles in different tissues or cell types. In reference , researchers noted an apparent contradiction in data regarding Ndfip1-deficient T cell responses. This can be resolved by considering:

    • Cell type-specific effects

    • Activation state-dependent functions

    • Compensatory mechanisms in different contexts

  • Experimental conditions: Standardizing experimental conditions is crucial. For instance, when studying T-cell responses, variables to control include:

    • Antigen concentration and presentation mode

    • Presence of co-stimulatory signals

    • Cytokine environment

    • Cell isolation and culture methods

  • Biological redundancy: Ndfip2 shares functional overlap with Ndfip1 in some contexts. Researchers should consider potential compensatory mechanisms, especially in acute knockout models where adaptation may occur.

By systematically addressing these factors, researchers can reconcile apparent contradictions and develop a more nuanced understanding of Ndfip1 function.

What are the current limitations in understanding the full spectrum of Ndfip1 targets?

Several limitations currently constrain our understanding of the full spectrum of Ndfip1 targets:

  • Methodological challenges:

    • Transient nature of ubiquitination events makes comprehensive target identification difficult

    • Potential targets may have low abundance or tissue-specific expression patterns

    • The subcellular localization of Ndfip1 in membrane compartments complicates protein interaction studies

  • Contextual variations:

    • Ndfip1 may recruit different E3 ligases in different cell types or conditions

    • Target specificity may change depending on cellular activation state

    • Post-translational modifications of Ndfip1 itself may alter target selection

  • Knowledge gaps:

    • Current studies have primarily focused on limited cellular contexts (T cells, neurons)

    • Most identified targets relate to immune function or neuronal plasticity

    • Potential roles in other biological processes remain largely unexplored

  • Technical limitations:

    • Antibody quality and specificity issues complicate reliable detection

    • Overexpression systems may identify non-physiological interactions

    • Limited temporal resolution in current experimental approaches

To address these limitations, researchers should consider employing emerging technologies such as proximity labeling combined with mass spectrometry, CRISPR-based screening approaches, and improved temporal control of Ndfip1 function through optogenetic or chemical genetic approaches.

How might therapies targeting the Ndfip1 pathway be developed for autoimmune disorders?

Developing therapies targeting the Ndfip1 pathway for autoimmune disorders requires consideration of several strategic approaches:

  • Enhancing Ndfip1 function:

    • Small molecule stabilizers of Ndfip1-Nedd4 interactions could enhance ubiquitination of pro-inflammatory factors

    • Cell-permeable peptide mimetics of Ndfip1 PY motifs might activate Nedd4 family E3 ligases

    • Gene therapy approaches to increase Ndfip1 expression in autoreactive T cells

  • Target-specific interventions:

    • Selective stabilization of JunB ubiquitination to limit Th2 responses

    • Modulation of specific downstream effectors like Notch signaling

    • Targeted approaches to enhance cell cycle exit in self-reactive T cells

  • Combination strategies:

    • Pairing Ndfip1 pathway modulation with existing immunosuppressants

    • Coordinating interventions targeting both Ndfip1 and other tolerance mechanisms

    • Cell type-specific delivery to reduce off-target effects

  • Therapeutic considerations:

    • Timing of intervention is critical, as Ndfip1 functions early in T-cell responses

    • Dosage modulation to avoid complete inhibition of appropriate immune responses

    • Potential tissue-specific effects, given Ndfip1's diverse roles

Research from reference indicates that Ndfip1 represents a critical element of a natural switch that allows T cells to decide between proliferating extensively or becoming tolerant. Therapeutics targeting this pathway could potentially enhance tolerance to self-antigens or transplanted organs while preserving normal immune function against pathogens.

How should researchers interpret changes in Ndfip1 expression levels in different experimental contexts?

Interpreting changes in Ndfip1 expression requires careful consideration of several factors:

  • Baseline expression considerations:

    • Ndfip1 is progressively induced during T-cell differentiation and activation

    • Expression patterns differ across tissues and cell types

    • Basal levels may vary between individuals or strains

  • Temporal dynamics:

    • Fast learners show decreased Ndfip1 expression compared to slow learners in spatial memory tasks

    • Spatial training decreases Ndfip1 mRNA and protein expression levels over time

    • Expression changes may be transient, requiring time-course analyses

  • Functional correlation:

    • Decreased Ndfip1 expression correlates with enhanced cognitive performance

    • Reduced Ndfip1 in T cells correlates with increased effector differentiation

    • The relationship between expression level and function may not be linear

  • Technical considerations:

    • Use multiple methods (qPCR, Western blot, reporter systems) to validate changes

    • Consider subcellular localization, not just total expression levels

    • Account for potential isoform-specific effects

What controls are essential when studying Ndfip1's role in protein ubiquitination?

When studying Ndfip1's role in protein ubiquitination, several essential controls should be implemented:

  • Genetic controls:

    • Complete Ndfip1 knockout (negative control)

    • Rescue experiments with wild-type Ndfip1 (specificity control)

    • PY motif mutants (mechanism control)

    • Ndfip1 conditional heterozygous models for dose-dependent effects

  • Biochemical controls:

    • E3 ligase-inactive mutants to confirm Nedd4-dependent effects

    • Non-ubiquitinatable substrate mutants (e.g., lysine-to-arginine mutations)

    • Proteasome inhibitors to distinguish degradative from non-degradative ubiquitination

    • Deubiquitinase inhibitors to stabilize transient ubiquitination events

  • Experimental design controls:

    • Time-course experiments to capture dynamic ubiquitination events

    • Subcellular fractionation to track compartment-specific modifications

    • Comparison of total protein levels versus ubiquitination status

    • Alternative ubiquitin linkage analysis (K48 vs. K63 chains)

  • Validation approaches:

    • Multiple independent ubiquitination detection methods

    • Correlation with functional outcomes

    • In vivo confirmation of in vitro findings

    • Substrate-specific phenotypic rescue experiments

For example, research has shown that spatial training decreases endogenous Beclin 1 and PTEN ubiquitination while increasing their expression levels in the hippocampus . These findings were validated by demonstrating that Becn1 and Pten conditional knockout mice show impaired spatial learning and memory performance, confirming the functional significance of these ubiquitination targets .

What are the most promising approaches for identifying novel Ndfip1-regulated pathways?

Several promising approaches could advance the identification of novel Ndfip1-regulated pathways:

  • Unbiased screening methods:

    • Proteomics-based ubiquitinome analysis in Ndfip1-deficient versus wild-type cells

    • CRISPR-based genetic screens to identify synthetic lethal or rescue interactions

    • Transcriptome profiling across multiple cell types and activation states

    • Metabolomic analysis to identify indirect effects on cellular metabolism

  • Tissue-specific investigations:

    • Conditional knockout models targeting understudied tissues

    • Single-cell approaches to identify cell type-specific regulatory networks

    • Organoid models to study Ndfip1 function in complex tissue environments

  • Physiological context expansion:

    • Exploration of Ndfip1 function in response to various stressors

    • Investigation of age-dependent changes in Ndfip1 regulation

    • Studies in disease models beyond current focus on allergy, autoimmunity, and memory

  • Evolutionary approaches:

    • Comparative studies across species to identify conserved functions

    • Analysis of the Ndfip1 interactome in organisms with different immune systems

    • Investigation of the Drosophila Ndfip1 ortholog to leverage genetic tools

Research has already established connections between Ndfip1 and diverse pathways including JunB/IL-4 signaling, Notch regulation, and TGFβ signaling , suggesting that Ndfip1 functions as an integration node for multiple cellular processes. Future research should systematically explore these and other potential regulatory networks.

How might single-cell technologies advance our understanding of Ndfip1 function?

Single-cell technologies offer several advantages for advancing our understanding of Ndfip1 function:

  • Heterogeneity resolution:

    • Identification of Ndfip1-responsive subpopulations within seemingly homogeneous tissues

    • Characterization of variable Ndfip1 expression across individual cells within the same lineage

    • Detection of rare cell populations with unique Ndfip1-dependent phenotypes

  • Temporal dynamics:

    • Tracking Ndfip1 expression changes throughout cell differentiation trajectories

    • Monitoring the kinetics of Ndfip1-dependent signaling at single-cell resolution

    • Capturing transient states during tolerance induction or memory formation

  • Multi-omics integration:

    • Correlation of Ndfip1 expression with transcriptome, proteome, and epigenome

    • Identification of target gene signatures associated with Ndfip1 activity

    • Mapping of Ndfip1-dependent protein-protein interaction networks

  • In vivo applications:

    • Spatial transcriptomics to map Ndfip1 activity in complex tissues

    • In situ protein detection to correlate Ndfip1 with target proteins in tissue contexts

    • Single-cell lineage tracing to follow the fate of Ndfip1-expressing cells

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.