Recombinant Mouse NEDD4 family-interacting protein 2 (Ndfip2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
Ndfip2; Kiaa1165; N4wbp5A; NEDD4 family-interacting protein 2; NEDD4 WW domain-binding protein 5A; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
RRSASDAELSAGAEGATGSEAAPPGDLGGRTRGGGRGSAAAAATTSTREAEGAERRGDTP ARKPDPEAGRMDHHQLGTGRYQVLHNEEDNSESSAVEQPSTSSLAAPTVEAAASAPALDP DSPPPYSSITVEAPTTSDTDVYSEFYPVPPPYSVATSLPTYDEAEKAKAAALAAAAADAP QRNQEEDCTPRDDFSDVEQLRVGNDGIFMLAFFMAFIFNWLGFCLSFCITNTIAGRYGAI CGFGLSLIKWILIVRFSDYFTGYFNGQYWLWWIFLVLGLLLFFRGFVNYLKVRNMSESMA AAHRTRYFFLL
Uniprot No.

Target Background

Function

NEDD4 family-interacting protein 2 (NDFIP2) activates HECT domain-containing E3 ubiquitin-protein ligases, including ITCH, NEDD4, NEDD4L, SMURF2, WWP1, and WWP2. This activation modulates the stability of their target proteins, influencing various cellular processes. NDFIP2 recruits ITCH, NEDD4, and SMURF2 to endosomal membranes. It negatively regulates KCNH2 potassium channel activity by reducing cell-surface expression and interfering with channel maturation. This interference involves recruiting NEDD4L to the Golgi apparatus and multivesicular bodies, where KCNH2 degradation is mediated. NDFIP2 may also modulate EGFR signaling. In conjunction with NDFIP1, it limits cytokine signaling and effector Th2 T-cell expansion by promoting JAK1 degradation, likely through ITCH- and NEDD4L-mediated ubiquitination.

Database Links
Subcellular Location
Endosome membrane; Multi-pass membrane protein. Golgi apparatus membrane. Endosome, multivesicular body membrane; Multi-pass membrane protein.
Tissue Specificity
Ubiquitously expressed, with highest levels in brain, liver, kidney and testis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.