Recombinant Mouse Neural proliferation differentiation and control protein 1 (Npdc1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse Neural Proliferation Differentiation and Control Protein 1 (Npdc1)

Neural proliferation differentiation and control protein-1 (NPDC1) is a protein predominantly expressed in the brain and lungs, playing a crucial role in regulating cellular proliferation and differentiation . It has been linked to retinoid signaling during embryonic differentiation in these organs . NPDC1 is involved in suppressing oncogenic transformation in both neural and non-neural cells and in down-regulating neural cell proliferation .

Regulation of NPDC1 Expression and Function

NPDC1 expression is regulated through multiple mechanisms, including protein degradation via the ubiquitin/proteasome degradation pathway .

  • Ubiquitin-Proteasome System: NPDC1 is degraded through the ubiquitin/proteasome system, a pathway involved in the turnover of proteins controlling proliferation and differentiation .

  • PEST Motif: A PEST motif located in the carboxyl terminus of NPDC1 targets the protein for degradation. Deletion of this motif increases NPDC1 protein stability and enhances its inhibitory effect on retinoic acid-mediated transcription .

  • Phosphorylation: NPDC1 can be phosphorylated by kinases, including extracellular signal-regulated kinase (ERK). Phosphorylation increases the rate of NPDC1 ubiquitination in vitro. Inhibition of ERK activation also inhibits the formation of ubiquitinated NPDC1 in vivo .

  • DNA Methylation: Significant correlation between NPDC1 methylation and patient prognosis suggests that DNA methylation affects NPDC1 gene expression .

Functional Roles of NPDC1

  • Regulation of Cell Proliferation and Differentiation: NPDC1 regulates cellular proliferation and differentiation, particularly in brain and lung tissues .

  • Interaction with Cyclins and Transcription Factors: NPDC1 binds to various cyclins and regulates differentiation events in neuronal precursor cells. It also binds to the transcription factor E2F-1, inhibiting its binding to DNA and subsequent transcription events .

  • Role in Tumorigenesis: NPDC1 may promote tumorigenesis, progression, and chemoresistance through various pathways . It is significantly overexpressed in colon cancer tumor tissues, with higher expression correlating with advanced patient age and tumor stage .

NPDC1 in Neurological Disorders

  • Parkinson's Disease: While not a direct study of NPDC1, research on NDI1, a related protein, showed that its expression could prevent the loss of dopamine and tyrosine hydroxylase in a mouse model of Parkinson's disorder, suggesting potential therapeutic applications for similar proteins in Parkinson-like conditions .

  • Brain Disorders: Aberrant expression of chloride transporters, including NKCC1, is implicated in several brain conditions. Selective NKCC1 inhibitors have shown promise in restoring physiological intracellular chloride levels and rescuing core symptoms in mouse models of Down syndrome and autism .

NPDC1 Expression and Clinical Data

The correlation between NPDC1 expression levels and clinical data, particularly in colon cancer, highlights its potential as a prognostic and predictive marker.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Npdc1; Npdc-1; Neural proliferation differentiation and control protein 1; NPDC-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
35-332
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Npdc1
Target Protein Sequence
RRPDATTCPGSLDCALKRRAKCPPGAHACGPCLQSFQEDQRGFCVPRKHLSSGEGLPQPR LEEEIDSLAQELALKEKEAGHSRLTAQPLLEAAQKLLEPAATLGFSQWGQRLEPGLPSTH GTSSPIPHTSLSSRASSGPVQMSPLEPQGRHGNGLTLVLILAFCLASSAALAVAALCWCR LQREIRLTQKADYAATAKGPTSPSTPRISPGDQRLAHSAEMYHYQHQRQQMLCLERHKEP PKELESASSDEENEDGDFTVYECPGLAPTGEMEVRNPLFDHSTLSAPVPGPHSLPPLQ
Uniprot No.

Target Background

Function
Recombinant Mouse Neural proliferation differentiation and control protein 1 (Npdc1) suppresses oncogenic transformation in neural and non-neural cells and down-regulates neural cell proliferation. It may also be involved in transcriptional regulation.
Gene References Into Functions
  1. Analysis of the upstream sequence of the mouse NPDC1 gene identified two regions involved in its negative and positive transcriptional regulation. PMID: 15563841
Database Links

KEGG: mmu:18146

STRING: 10090.ENSMUSP00000071387

UniGene: Mm.1131

Protein Families
NPDC1/cab-1 family
Subcellular Location
Membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in the brain and nervous system. Not detected in liver, heart, skeletal muscle, spleen, pancreas, pituitary and adrenal glands. Expression increases when cultured neural cells are growth-arrested and begin to differentiate.

Q&A

What is NPDC1 and what are its primary functions in cellular processes?

NPDC1 is an O-linked glycoprotein primarily expressed in lung and neural tissues involved in regulating cellular proliferation and differentiation. The protein is expressed when neuronal precursor cells cease division and begin differentiation .

Structurally, mouse NPDC1 consists of:

  • An extracellular domain (ECD) with a potential HLH-like domain

  • A transmembrane domain

  • A cytoplasmic domain containing a PEST motif (rich in proline, glutamine, serine, and threonine) that targets the protein for degradation

Functionally, NPDC1:

  • Interacts with transcription factor E2F-1, inhibiting its DNA binding capabilities and corresponding transcription events

  • Binds various cyclins and regulates differentiation events in neuronal precursor cells

  • Has been identified as a novel ligand for PILR alpha, binding through sialylation-dependent recognition

  • Potentially regulates cell cycle and differentiation processes

  • May be connected to intestinal neuropeptide secretion pathways that influence axonal regeneration

How does the structure of recombinant mouse NPDC1 differ from the native protein?

Recombinant mouse NPDC1 protein is engineered for research applications and typically includes structural modifications:

FeatureNative Mouse NPDC1Recombinant Mouse NPDC1 Fc Chimera
StructureFull protein with ECD, transmembrane, and cytoplasmic domainsTypically contains Ala32-Thr190 portion with Thr33Leu modification fused to human IgG1 Fc (Pro100-Lys330)
Molecular Weight~34 kDa native form54-62 kDa (reduced), 108-124 kDa (non-reduced)
GlycosylationO-linked glycosylationMay contain modified glycosylation based on expression system
SolubilityMembrane-associatedSoluble due to lack of transmembrane domain

The recombinant version of mouse NPDC1 typically focuses on the functional extracellular domain while removing the transmembrane and cytoplasmic regions to enhance solubility and experimental utility .

What are the key differences between mouse and human NPDC1?

Understanding cross-species conservation of NPDC1 is crucial for translational research:

FeatureMouse NPDC1Human NPDC1
ECD Sequence Identity100% (reference)76% identity with mouse NPDC1 ECD
SizeSimilar to humanHuman: ~34 kDa protein
StructureContains HLH-like domain, transmembrane domain and PEST motifContains 34 aa signal peptide, 147 aa ECD, 21 aa transmembrane region, and PEST motif
Expression PatternPrimarily neural tissues and lungPrimarily neural tissues and lung
FunctionNeural differentiation, cell cycle regulationSimilar functions; potentially tumor suppressive

Researchers should note these differences when extrapolating findings between species, particularly for antibody-based detection methods and functional studies .

How is NPDC1 expression linked to cancer progression, particularly in colon cancer?

NPDC1 has emerged as a significant biomarker in colon cancer research, with specific correlations to disease outcomes:

Mechanistically, NPDC1 may contribute to colon cancer progression through:

  • Promotion of tumorigenesis and progression through various related pathways

  • Potential role in chemoresistance development

  • Association with immune infiltration patterns in digestive system tumors

  • Correlation with tumor mutation burden (TMB) in colon cancer (p < 0.05)

Research methodologies for investigating NPDC1 in cancer include:

  • Immunohistochemical validation in tissue samples (384 colon cancer tissues were used in the cited study)

  • Bioinformatics analysis using databases such as TCGA, GEPIA, and CCLE

  • Correlation analysis with clinicopathological features and survival data

  • Gene function, survival, and pathway analyses focusing on NPDC1

What experimental designs are most effective for studying NPDC1 function in neural development?

When designing experiments to study NPDC1's role in neural development, researchers should consider a multi-faceted approach:

  • Sequential Optimal Experimental Design

    • Implement a sequential approach that interleaves machine learning models with wet-lab experiments

    • Select perturbation experiments that will most benefit the model in predicting unprofiled perturbations

    • Sample the perturbation space intelligently by considering informative and representative perturbations

  • Robust Controls Implementation

    • Incorporate positive controls (known conditions expected to produce predictable effects)

    • Include negative controls to guard against artifacts and non-specific effects

    • Use normalization controls to ensure data comparability across experimental conditions

  • Replication Strategy

    • Address biological variability through adequate biological and technical replicates

    • Determine appropriate sample size through power analysis before experimentation

    • Apply randomization and blocking techniques to minimize bias

  • Expression Analysis Framework

    • Track NPDC1 expression during neural precursor cell differentiation stages

    • Correlate expression with cell cycle exit and initiation of differentiation

    • Analyze interaction with E2F-1 and corresponding transcriptional events

What methods are most reliable for detecting and measuring NPDC1 in experimental samples?

Detection and quantification of NPDC1 requires careful selection of methods based on research objectives:

MethodApplicationConsiderations
Western BlottingProtein expression quantificationRecombinant Mouse NPDC1 Fc Chimera can be resolved with SDS-PAGE under reducing and non-reducing conditions, showing bands at 54-62 kDa and 108-124 kDa, respectively
ImmunohistochemistryTissue localizationValidated antibodies are critical; custom antibodies may be necessary for specific applications
qRT-PCRmRNA expressionCareful primer design needed due to potential alternative splicing
ELISAQuantitative protein measurementRecombinant proteins can serve as standards
Flow CytometryCell-specific expressionAppropriate for detecting NPDC1 in mixed cell populations
ImmunofluorescenceSubcellular localizationAllows visualization of NPDC1 distribution within cells

For recombinant protein experiments, researchers should consider:

  • Carrier-free formulations when presence of BSA could interfere with applications

  • Proper reconstitution procedures (e.g., reconstituting lyophilized protein at 1 mg/mL in PBS)

  • Appropriate storage conditions to avoid repeated freeze-thaw cycles

How can bioinformatics approaches be utilized to investigate NPDC1-associated genes and pathways?

Bioinformatics strategies have proven valuable for uncovering NPDC1's broader functional network:

  • Database Integration Approach

    • Utilize large databases (TCGA, GEPIA, CCLE, Proteinatlas, cBioportal) to examine NPDC1 expression patterns across tissue types

    • Create mulberry plots using R package "ggalluvial" to visualize gene expression patterns in various clinical contexts

    • Apply Kruskal-Wallis test to evaluate differences in gene expression between groups

  • Methylation Analysis Framework

    • Examine expression and prognosis of each CpG methylation of NPDC1 using specialized databases (e.g., MethSurv)

    • Analyze correlation between methylation status and patient outcomes

  • Immune Infiltration Analysis

    • Implement "immunedeconv" R package to analyze immune infiltration, integrating multiple algorithms (TIMER, xCell, MCP-counter, CIBERSORT, EPIC, quanTIseq)

    • Examine immune checkpoint transcripts (SIGLEC15, IDO1, CD274) in relation to NPDC1 expression

  • Correlation Network Construction

    • Identify genes positively and negatively correlated with NPDC1 expression

    • Found significant negative correlation with LAMP2 and ATP6AP2

    • Found significant positive correlation with HMG20B and GRIN1

What risk score models incorporating NPDC1 have prognostic value in cancer research?

NPDC1 has been incorporated into risk score models with significant prognostic value:

The optimal model developed in colon cancer research uses the following formula:
Riskscore = (0.3629) × NPDC1 + (−0.1046) × JUN + (−0.5438) × CCNB1 + (−0.0734) × CCND1 + (0.0078) × CDC6 + (0.0259) × CCND2 + (0.1744) × E2F1 + (0.3999) × CDK2 + (0.6057) × CCNA1

This model has demonstrated:

  • Effectiveness as a poor prognostic predictor in colon cancer patients

  • Kaplan-Meier survival analysis showing worse prognosis for the high-risk group

  • Independent prognostic value of NPDC1 confirmed through multi-way Cox regression analysis

  • Capability to estimate patient survival rates for 1, 3, and 5 years

Implementing such risk score models requires:

  • Comprehensive data collection on gene expression profiles

  • Statistical validation through multiple regression analyses

  • Survival analysis using Kaplan-Meier methods

  • Column line graph visualization for survival rate estimation

What are the recommended protocols for using recombinant NPDC1 in functional studies?

When designing experiments with recombinant NPDC1, researchers should follow these methodological guidelines:

  • Protein Preparation

    • Reconstitute lyophilized recombinant mouse NPDC1 at 1 mg/mL in PBS

    • Store reconstituted protein in a manual defrost freezer and avoid repeated freeze-thaw cycles

    • Use carrier-free versions when the presence of BSA could interfere with applications

  • Quality Control Verification

    • Confirm protein quality via SDS-PAGE under reducing and non-reducing conditions

    • Expected bands: 54-62 kDa (reduced) and 108-124 kDa (non-reduced) for mouse NPDC1 Fc chimera

    • For human NPDC1, a molecular weight of approximately 34 kDa is expected

  • Functional Binding Assays

    • Design experiments to investigate NPDC1's interaction with:

      • Transcription factor E2F-1

      • D-type cyclins and cdk2

      • PILR alpha (through sialylation-dependent recognition)

  • Expression Studies

    • Compare NPDC1 expression across neural development stages

    • Correlate expression with cell cycle exit and initiation of differentiation

    • Investigate effects on downstream targets when NPDC1 is overexpressed or knocked down

How should researchers design robust experiments to study NPDC1's role in perineural invasion?

Designing experiments to investigate NPDC1's role in perineural invasion requires a comprehensive approach:

  • Study Design Framework

    • Implement a sequential optimal design procedure that interleaves machine learning models with wet-lab experiments

    • At each step, acquire data, retrain the model, and select perturbations that will most benefit the model

    • Include appropriate controls, replicates, and blinding to ensure robust results

  • Tissue Collection and Analysis

    • Collect paired tumor and normal tissues with detailed clinical information

    • Examine 384+ colon cancer tissues using immunohistochemical techniques to validate NPDC1 expression

    • Correlate expression with clinicopathological characteristics and patient survival data

  • PNI Evaluation Criteria

    • Define PNI as tumor invasion of nerve structure layers (epineurium, perineurium, and endoneurium)

    • Consider tumors as PNI-positive when they cover >33% of the nerve's perimeter

    • Analyze correlation between NPDC1 expression and PNI status

  • Data Analysis Approach

    • Create a riskscore model incorporating NPDC1 and related genes

    • Use multivariate Cox regression analysis to assess NPDC1 as an independent prognostic factor

    • Employ Kaplan-Meier survival analysis to compare outcomes based on NPDC1 expression levels

What are the key considerations when validating antibodies against NPDC1 for research applications?

Antibody validation is critical for accurate NPDC1 detection and experimental reproducibility:

  • Validation Criteria

    • Verify antibody specificity through multiple independent techniques

    • Confirm antibody performance across intended applications (WB, IHC, IF, Flow)

    • Test for cross-reactivity, especially when working across species (mouse NPDC1 shares 76% amino acid sequence identity with human NPDC1)

  • Positive and Negative Controls

    • Use recombinant NPDC1 proteins as positive controls

    • Include tissue samples with known high expression (neural tissues, lung) as biological positive controls

    • Implement appropriate negative controls (tissues known to lack NPDC1 expression)

  • Custom Antibody Development

    • Consider custom antibody development for specific applications or epitopes

    • Ensure proper design of immunogens based on NPDC1 structure

    • Validate using recombinant technology approaches that produce consistent, high-quality antibodies

  • Performance Guarantees

    • Select antibodies with performance guarantees when possible

    • Document antibody lot information and validation data

    • Consider replacement options if antibodies don't perform as described

How can researchers effectively integrate bioinformatics and wet-lab approaches to study NPDC1?

Integration of computational and experimental approaches strengthens NPDC1 research:

  • Sequential Experimental Design

    • Begin with bioinformatics screening to identify genes associated with NPDC1

    • Use computational analysis to guide wet-lab experiments

    • Implement a feedback loop where experimental results inform subsequent computational analyses

  • Database Utilization Strategy

    • Extract NPDC1 expression data from large databases (TCGA, GEPIA, CCLE)

    • Create visualization tools (Mulberry plots) to represent gene expression patterns

    • Use statistical tests (Kruskal-Wallis) to examine differences between groups

  • Validation Framework

    • Confirm bioinformatics findings through immunohistochemical techniques

    • Correlate expression with clinicopathological characteristics and survival data

    • Develop and test mathematical models for predicting patient outcomes

  • Integrated Analysis Approach

    • Combine immune infiltration analysis with NPDC1 expression data

    • Identify genes positively and negatively correlated with NPDC1

    • Create comprehensive models that account for multiple molecular features

This integrated approach ensures that computational predictions are grounded in biological reality, while experimental designs are informed by comprehensive data analysis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.