Recombinant Mouse Neurensin-1 (Nrsn1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Nrsn1; Vmp; Neurensin-1; Neuro-p24; Vesicular membrane protein of 24 kDa; Vesicular membrane protein p24
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-196
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Nrsn1
Target Protein Sequence
MTSCSNTCGSRRAQADTEGGYQQRYGVRSYLHQFYEDCTASIWEYEDDFQIQRSPNRWSS VFWKVGLISGTVFVILGLTVLAVGFLVPPKIEAFGEADFMVVDTHAVKYNGALDTCKLAG AVLFCIGGTSMAGCLLMSVFAKSYSKEEKFLQQKFKERIADIKAHTQPITKAPGPGDTKI PVTLSRVQNVQPLSAT
Uniprot No.

Target Background

Function
Neurensin-1 may play a crucial role in neural organelle transport, nerve signal transduction, and nerve growth. It may also contribute to neurite extension.
Gene References Into Functions
  1. Studies show that hippocampal overexpression of Nrsn1, a gene exhibiting rapid translational repression, or ESR1 activation, impairs memory formation. (PMID: 26430118)
  2. Neurensin-2 is localized within small vesicles, including lysosomes in the perinuclear region and cell bodies. (PMID: 16527258)
  3. Neurensin-1 contributes to retinal neuron fiber extension, making the developing retina a suitable model for in vivo and in vitro analysis of its function. (PMID: 16696124)
  4. Research indicates that Nrsn1 actively participates in axonal regeneration and embryonic development. (PMID: 17566649)
Database Links

KEGG: mmu:22360

UniGene: Mm.4766

Protein Families
VMP family
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, neuron projection.
Tissue Specificity
Expressed predominantly in brain. Also weakly expressed in lung and spleen. In brain, expressed strongly in nerve fibers of the cerebral cortex, anterior cerebral nuclei, hypothalamus, amygdaloid complex, brain stem of the metaencephalon and medulla oblon

Q&A

What is Recombinant Mouse Netrin-1 and what are its key structural features?

Recombinant Mouse Netrin-1 is a member of the laminin-related family of axon-guidance molecules. The molecule's cDNA encodes a 603 amino acid protein precursor with structural similarity to the N-terminal gamma-chain of laminin. Its structure includes a globular domain, three EGF repeats, and a C-terminal heparin-binding domain . The commercially available recombinant protein typically spans from Val22 to Ala603 with accession number AAC52971, and often includes terminal tags to facilitate purification and detection .

Structurally, Mouse Netrin-1 shares 52% amino acid identity with mouse Netrin-3, and demonstrates high conservation across species with 98% amino acid identity with human Netrin-1 and 87% identity with chicken Netrin-1 . This high degree of conservation underscores its evolutionary importance in neural development. The recombinant protein is typically produced with either a carrier protein for enhanced stability or in carrier-free formulations for applications where carrier proteins might interfere with experimental outcomes.

How should Recombinant Mouse Netrin-1 be stored and reconstituted for optimal activity?

Proper storage and reconstitution are critical for maintaining the biological activity of Recombinant Mouse Netrin-1. The protein is typically shipped at ambient temperature in lyophilized form, but should be stored immediately upon receipt according to manufacturer recommendations . To maintain optimal activity, researchers should use a manual defrost freezer and avoid repeated freeze-thaw cycles, as these can significantly reduce protein activity and integrity .

For reconstitution of standard formulations containing bovine serum albumin (BSA) as a carrier protein, the lyophilized protein should be reconstituted at 100 μg/mL in sterile PBS containing at least 0.1% human or bovine serum albumin . For carrier-free formulations, reconstitution at 100 μg/mL in sterile PBS is recommended . Regardless of formulation, reconstituted protein should be aliquoted to minimize freeze-thaw cycles and stored according to the manufacturer's stability data. Working solutions should be prepared fresh for experiments to ensure consistent biological activity across studies.

What is the difference between carrier-free and BSA-containing formulations?

Carrier-free (CF) formulations of Recombinant Mouse Netrin-1 do not contain bovine serum albumin (BSA), while standard formulations include BSA as a carrier protein. The addition of a carrier protein such as BSA enhances protein stability, increases shelf-life, and allows the recombinant protein to be stored at more dilute concentrations . These benefits make BSA-containing formulations generally preferred for most laboratory applications.

The carrier-free version is specifically formulated for applications where BSA might interfere with experimental outcomes . The formulation differences extend to the excipients used: BSA-containing formulations are typically lyophilized from a 0.2 μm filtered solution in HEPES and NaCl with BSA, while carrier-free versions are lyophilized from a 0.2 μm filtered solution in HEPES and NaCl with Trehalose as a stabilizing agent . When deciding between formulations, researchers should consider their specific experimental requirements, particularly when working with systems sensitive to exogenous proteins or when conducting studies where precise protein quantification is essential.

In which experimental systems has Recombinant Mouse Netrin-1 been validated?

Based on citation data from published research, Recombinant Mouse Netrin-1 has been validated in diverse experimental systems spanning multiple species and sample types. In mouse models, it has been used in whole cell assays studying neuronal development, osteoclast differentiation, and adipose tissue macrophage behavior . Rat experimental systems include whole cell and whole tissue applications focusing on axonal transport, exocytosis patterns in growth cones, and Parkinsonian models .

Human cell studies have utilized Recombinant Mouse Netrin-1 to investigate embryonal carcinoma cell differentiation and Alzheimer's disease-linked mutations affecting netrin receptor signaling . Beyond neural applications, the protein has been validated in studies of renal ischemia-reperfusion injury, mammary gland morphogenesis, and inflammatory responses to hypoxia . This broad utility across species and tissue types demonstrates the conserved nature of Netrin-1 signaling pathways and illustrates the versatility of this reagent in both neural and non-neural research applications.

How can Recombinant Mouse Netrin-1 be optimally used in axon guidance assays?

When designing axon guidance assays using Recombinant Mouse Netrin-1, researchers should consider both gradient formation and receptor expression. Based on published methodologies, effective concentration ranges typically fall between 50-250 ng/mL for gradient-based assays, with higher concentrations potentially causing receptor desensitization . For optimal results, gradients should be established in collagen or matrigel matrices rather than liquid media to maintain stability throughout the experiment duration.

Critical methodological considerations include pre-testing receptor expression in the neuronal population of interest, as Netrin-1's effects depend on the relative expression of attractive (DCC, Neogenin) versus repulsive (UNC5 family) receptors . Control conditions should include both vehicle controls and non-gradient uniform Netrin-1 application to distinguish between growth-promoting and directional effects. Time-lapse imaging over 12-24 hours typically provides the most informative data, capturing both initial responses and potential adaptation. Validation experiments should include receptor-blocking antibodies or genetic knockdown approaches to confirm specificity of observed effects and rule out off-target interactions with other guidance systems.

What methodological approaches reveal Netrin-1's dual function in attraction and repulsion?

The dual attractive and repulsive functions of Netrin-1 can be methodologically investigated through receptor manipulation experiments. Several studies demonstrate that the cellular context, particularly the complement of netrin receptors expressed, determines whether Netrin-1 exerts attractive or repulsive effects . To study this duality, researchers have employed genetic approaches to selectively express or knock down specific receptors in neuronal populations.

A methodologically sound experimental design includes parallel cultures of neurons with defined receptor expression patterns, exposed to identical Netrin-1 concentrations. For example, commissural axons expressing predominantly DCC receptors show attraction, while those with higher UNC5 expression demonstrate repulsion . Advanced time-lapse microscopy combined with fluorescent tagging of cytoskeletal components can reveal the differential effects on growth cone dynamics. Additionally, second messenger investigations (cAMP/cGMP levels) have proven valuable, as modulating these pathways can switch Netrin-1's effect from attraction to repulsion. Recent studies have also employed microfluidic devices to create precisely controlled gradients, allowing researchers to observe how the same neuronal population responds differently to Netrin-1 as receptor expression changes during development or following experimental manipulation .

What are effective approaches for studying Netrin-1 signaling in disease models?

Several methodological approaches have proven effective for investigating Netrin-1 signaling in disease models, particularly neurodegenerative conditions and inflammatory disorders. In Parkinson's disease models, researchers have successfully used Recombinant Mouse Netrin-1 to study its effects on axonal transport in dopaminergic neurons exposed to toxins like MPP+ and 6-OHDA . These studies typically combine live-cell imaging of fluorescently labeled mitochondria or vesicles with Netrin-1 treatment to assess rescue effects on impaired transport.

For stroke models, researchers have employed both in vitro oxygen-glucose deprivation paradigms and in vivo middle cerebral artery occlusion models to study Netrin-1's neuroprotective effects . The regulatory role of Netrin-1 in neuronal pyroptosis after stroke has been investigated using immunohistochemistry, Western blotting, and ELISA techniques to measure inflammatory markers . In metabolic disease research, researchers have used diet-induced obesity models to study how Netrin-1 promotes adipose tissue macrophage retention and insulin resistance, employing flow cytometry to track macrophage populations and glucose tolerance tests to assess metabolic outcomes . For all disease models, experimental design should include appropriate timing of Netrin-1 administration relative to disease induction, dose-response studies, and pathway-specific inhibitors to delineate mechanisms.

How can researchers validate biological activity of Recombinant Mouse Netrin-1?

Validating the biological activity of Recombinant Mouse Netrin-1 requires functional assays appropriate to the experimental context. The most widely accepted validation approach uses commissural axon outgrowth assays, where spinal cord explants from E11-E13 mouse embryos are cultured in three-dimensional matrices with Netrin-1 . Active Netrin-1 produces directional outgrowth of commissural axons toward the protein source, which can be quantified by measuring neurite length and directional bias.

For non-neural applications, validation methods depend on the specific biological process under investigation. In studies of osteoclast differentiation, researchers have validated Netrin-1 activity by measuring TRAP-positive multinucleated cell formation in bone marrow-derived macrophage cultures treated with Netrin-1 . For inflammatory models, biological activity can be confirmed by measuring cytokine production (particularly IL-1β, TNF-α, and IL-6) in macrophages or microglia following Netrin-1 treatment . Cell migration assays using Boyden chambers or real-time cell analysis systems provide another validation approach, particularly for cancer cell lines or immune cells known to respond to Netrin-1. Regardless of the validation method chosen, including positive controls (known Netrin-1 responsive cells) and specificity controls (receptor blocking) strengthens the reliability of activity assessment.

What approaches are effective for studying non-neural roles of Netrin-1?

The non-neural functions of Netrin-1 have emerged as an important research area, requiring specific methodological approaches. For studying Netrin-1's role in angiogenesis and vascular development, researchers have employed endothelial cell tube formation assays, directional migration assays, and in vivo matrigel plug assays with Recombinant Mouse Netrin-1 . These approaches have revealed that Netrin-1 can either promote or inhibit angiogenesis depending on the receptor expression pattern of endothelial cells.

For investigating Netrin-1's functions in inflammation, researchers have used models of acute inflammatory conditions such as ischemia-reperfusion injury and acute pancreatitis . In these contexts, Netrin-1 treatment has demonstrated anti-inflammatory properties by modulating leukocyte migration and cytokine production. Flow cytometry analysis of immune cell populations, multiplex cytokine assays, and intravital microscopy to visualize leukocyte-endothelial interactions have proven valuable methodological approaches .

In the study of mammary gland development, researchers have applied Recombinant Mouse Netrin-1 to mammary epithelial cell cultures and analyzed effects on branching morphogenesis, cell proliferation, and differentiation . Three-dimensional organoid cultures combined with immunofluorescence staining for structural markers provide particularly informative data about Netrin-1's morphogenic effects outside the nervous system. These methodological approaches leverage the established technical protocols from neuroscience research but adapt them to address tissue-specific questions in non-neural contexts.

Experimental SystemValidated Applications of Recombinant Mouse Netrin-1Key MethodsRepresentative Citations
Neural DevelopmentAxon guidance, neuroblast migration, commissural axon outgrowthExplant cultures, growth cone turning assays
Neurodegenerative ModelsProtection against MPP+/6-OHDA toxicity, stroke-induced apoptosisLive-cell imaging, axonal transport assays
InflammationAnti-inflammatory effects in ischemia-reperfusion, regulation of Th1/Th2/Th17 cytokinesFlow cytometry, cytokine profiling
Mammary GlandMorphogenesis and differentiation3D organoid cultures, branching quantification
Osteoclast BiologyDifferentiation of osteoclast precursorsTRAP staining, multinucleated cell quantification
MetabolismAdipose tissue macrophage retention, insulin resistanceGlucose tolerance tests, adipose tissue analysis

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.