Recombinant Mouse Neurensin-2 (Nrsn2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
Nrsn2; Gm123; Neurensin-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Nrsn2
Target Protein Sequence
MSCSRPCVCSHGTSVEESTWYGFDFYPNLFYNDWLGTTTLPYNPERIPIRYINRPWPSLC WKVTVAVASLFLLLGVAALTTGYAVPPKLELVNESKFSSMEDPVADYNQALMTCRVVGAT LCGVAGIMLAVCLFLIASGWMFQDIKAEPLVTETDSPVEVFRDEPEKLSPAFHETSSQSP FLTPPSPFGQQSVQTSQPQRDL
Uniprot No.

Target Background

Function
May play a role in vesicle maintenance and/or transport.
Database Links
Protein Families
VMP family
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed specifically in brain where it is widely expressed, with highest levels of expression in thalamus and hypothalamus. In brain, found in neural cell bodies and detected in many regions of the limbic system, such as the septum nucleus, horizontal a

Q&A

What is Neurensin-2 and what are its fundamental structural characteristics?

Neurensin-2 (Nrsn2) is a 204 amino acid multi-pass membrane protein belonging to the vesicular membrane protein (VMP) family. It is primarily involved in the transport and maintenance of vesicles in neuronal cells. The protein is encoded by the Nrsn2 gene, which maps to chromosome 20 in humans and produces a neuronal-specific vesicular protein . In its wild-type form, Neurensin-2 consists of 202 amino acids in mouse models, though truncated versions (such as the 21 amino acid version produced in certain knockout models) have been studied experimentally .

Structurally, Neurensin-2 is characterized by its localization to membranes and vesicular structures, consistent with its putative role in vesicular transport and maintenance. Unlike its paralog Neurensin-1, Neurensin-2 shows distinct expression patterns and functional properties .

Where is Neurensin-2 primarily expressed in the mouse brain?

Neurensin-2 displays a highly specific expression pattern in the mouse brain. It is predominantly expressed in:

  • Hippocampus: Particularly in the dentate gyrus, with selective expression in GABAergic interneurons

  • Cell bodies in the diagonal band

  • Amygdaloid nucleus

  • Habenula nucleus

  • Cerebellar Purkinje cells (GABAergic neurons)

Most notably, within the hippocampus, Neurensin-2 is highly and selectively enriched in specific subpopulations of GABAergic interneurons, including:

  • Almost all parvalbumin (PV)-positive interneurons in the subgranular zone (SGZ)

  • The vast majority of cholecystokinin (CCK)-expressing interneurons

  • A small subset of GABAergic interneurons proximate to pyramidal cells throughout the hippocampus

Importantly, Neurensin-2 is not significantly expressed in cortistatin-positive neurons, which typically co-express somatostatin .

How can researchers reliably detect and quantify Neurensin-2 in experimental samples?

Multiple validated approaches exist for detecting and quantifying Neurensin-2:

  • ELISA-based quantification: Mouse Neurensin-2 ELISA kits provide in vitro quantitative measurement of Neurensin-2 concentrations in tissue homogenates, cell lysates, and other biological fluids with a typical detection range of 0.156-10 ng/ml .

  • Immunohistochemical analysis: This approach allows visualization of Neurensin-2 expression patterns within tissue sections and has been successfully used to identify Neurensin-2-positive interneurons in the hippocampal dentate gyrus .

  • Western blot analysis: This technique can confirm alterations in Neurensin-2 protein levels in hippocampal lysates and other tissue preparations .

  • qPCR analysis: Quantitative PCR provides a reliable method for measuring Nrsn2 transcript levels in isolated cell populations, such as CCK-positive interneurons .

  • Translating Ribosome Affinity Purification (TRAP): This advanced technique allows cell-type-specific profiling of Nrsn2 expression using mouse lines expressing loxP-stop-loxP-EGFP-RPL10a in specific neuronal populations .

What are the most effective methods for generating and validating Neurensin-2 knockout models?

Based on published research protocols, an effective Neurensin-2 knockout model can be generated using CRISPR/Cas9 technology with the following methodological considerations:

  • gRNA design and validation: Multiple CRISPR gRNAs targeting Nrsn2 exon 2 should be designed using computational tools such as Benchling and CRISPOR. All candidate guides should undergo in vivo validation in mouse embryonic stem cells (mESCs) and zygotes to assess cleavage efficiency and indel patterns .

  • Optimal guide selection: Select a guide targeting Nrsn2 exon 2 that mediates a frameshift mutation (such as a 5 bp deletion) introducing a premature stop codon. This approach has been successfully used to create truncated Nrsn2 protein (21 amino acids) instead of the wild-type 202 amino acid protein .

  • Delivery methods: The selected guide can be delivered with Cas9 as a ctRNP complex (containing CrRNA, tracrRNA, and HiFi Cas9) into mouse zygotes via either:

    • Pronuclear injection

    • Improved-Genome editing via Oviductal Nucleic Acid Delivery (iGONAD)

  • Founder selection and validation: Pups carrying the desired deletion should be confirmed by PCR and Sanger sequencing before being selected as founders for breeding .

  • Knockout validation: Comprehensive validation should include:

    • Protein level assessment via Western blot

    • Functional studies to confirm altered phenotypes

    • qPCR analysis to confirm transcript disruption

How can cell-type-specific Neurensin-2 expression be analyzed in the mouse brain?

Given Neurensin-2's distinct expression pattern in specific neuronal populations, cell-type-specific analysis is crucial and can be accomplished through:

  • Cell-type-specific TRAP approach: This involves crossing mice expressing Cre recombinase under control of cell-type-specific promoters (such as CCK-Cre, GAD2-Cre, or PV-Cre) with mice expressing loxP-stop-loxP-EGFP-RPL10a under the Eef1α1 promoter. This strategy enables isolation of actively translating mRNAs from specific cell types, allowing precise measurement of Nrsn2 expression .

  • Fluorescence-activated nuclei sorting (FANS):

    • Isolate nuclei from specific cell populations

    • Label with appropriate dyes (e.g., DyeCycle Ruby)

    • Sort GFP-positive nuclei using FACSAria cell sorter

    • Validate sorting purity by post-sorting assessment of GFP-positive nuclei

  • Immunohistochemical co-localization: Using antibodies against Neurensin-2 alongside markers for specific interneuron subtypes (PV, CCK, somatostatin) to quantify co-expression patterns. This approach has revealed that Neurensin-2 is present in approximately 90% of CCK cells and nearly 100% of PV neurons in the SGZ .

What experimental approaches can demonstrate the functional relationship between Neurensin-2 and AMPA receptor signaling?

The relationship between Neurensin-2 and AMPA receptor signaling can be investigated through several complementary approaches:

  • Differential gene expression analysis: RNA-seq analysis of hippocampal interneurons can identify changes in genes associated with excitatory synapses and postsynaptic density. This approach has shown that approximately 26% of postsynaptic membrane-related differentially expressed genes are associated with AMPAR signaling in CCK cells when SMARCA3 is deleted (leading to Neurensin-2 upregulation) .

  • Genetic manipulation studies: Both Neurensin-2 knockout and overexpression models can be used to assess:

    • AMPA receptor localization to synapses

    • Synaptic strength measurements

    • Functional electrophysiological changes

  • Synaptic protein localization studies: These can directly visualize changes in AMPA receptor trafficking and membrane localization following Neurensin-2 manipulation, providing mechanistic insights into how Neurensin-2 influences glutamatergic signaling .

How does Neurensin-2 contribute to emotional behavior regulation and what are the optimal behavioral testing paradigms?

Neurensin-2 plays a significant bidirectional role in emotional behavior regulation, particularly related to stress responses and depression-like behaviors. The following experimental paradigms are recommended for investigating these functions:

  • Chronic stress paradigms: These can demonstrate how stress exposure alters Neurensin-2 expression in the hippocampus, which subsequently influences behavioral outcomes. Important measures include:

    • Changes in Neurensin-2 protein levels via Western blot

    • Behavioral assessments of depression-like phenotypes

    • Assessment of glutamatergic signaling changes

  • Viral-mediated overexpression studies: Targeted viral delivery allows region-specific overexpression of Neurensin-2, enabling researchers to observe resulting behavioral changes that mimic stress-induced alterations. This approach has shown that hippocampal Neurensin-2 upregulation results in depressive-like behaviors .

  • Knockout/knockdown models: Deletion or downregulation of Neurensin-2 can reveal its role in stress resilience and emotional regulation. These models have demonstrated that Neurensin-2 deletion confers resilience to stress .

  • Pharmacological intervention studies: Testing how antidepressant treatments might modulate Neurensin-2 expression can provide insights into potential therapeutic mechanisms, particularly through the SMARCA3-mediated pathway that represses Neurensin-2 expression .

What is the relationship between SMARCA3, Neurensin-2, and antidepressant responses?

A complex regulatory relationship exists between the chromatin-remodeler SMARCA3 and Neurensin-2, with significant implications for antidepressant responses:

  • Repressive regulation: SMARCA3 mediates transcriptional repression of Neurensin-2, as evidenced by:

    • Upregulation of Nrsn2 transcript levels in CCK cells from SMARCA3 conditional knockout mice

    • Increased Neurensin-2 protein levels in hippocampal lysates from these conditional knockout mice

  • Cell-type specificity: This regulatory mechanism appears to operate in specific interneuron populations, particularly CCK- and PV-positive cells, but not in cortistatin-expressing neurons .

  • Antidepressant pathway: SMARCA3 has been implicated in mediating responses to chronic antidepressants, suggesting that its repressive effect on Neurensin-2 may be part of the therapeutic mechanism of these medications .

  • Molecular pathway complexity: The SMARCA3-Neurensin-2 pathway influences glutamatergic signaling in interneurons, particularly affecting AMPA receptor localization to synapses, which is a known mechanism involved in rapid-acting antidepressant effects .

How does Neurensin-2 function differ between neuropsychiatric and oncological contexts?

Neurensin-2 exhibits context-dependent functions that appear to differ significantly between neuronal tissues and cancer cells:

  • Neuropsychiatric context: In the brain, particularly in GABAergic interneurons, Neurensin-2:

    • Regulates vesicular transport

    • Influences glutamatergic signaling

    • Modulates emotional behaviors

    • Affects stress responses

  • Oncological context: In cancer contexts, Neurensin-2 has shown:

    • Potential tumor suppressor activity in hepatocellular carcinoma (HCC), serving as a candidate biomarker for long-term survival

    • Paradoxically, a cancer-promoting role in HPV-infected laryngeal carcinoma (LC) through regulation of autophagy via the AMPK/ULK1 pathway

  • Reconciling divergent functions: These apparently contradictory roles may be explained by:

    • Tissue-specific protein interaction networks

    • Different downstream signaling pathways in neurons versus cancer cells

    • Unique regulatory mechanisms in different cellular contexts

What experimental approaches best capture Neurensin-2's role in cancer progression?

Several experimental approaches can effectively investigate Neurensin-2's functions in oncological contexts:

  • Gene knockdown studies: Inhibition of NRSN2 in cancer cell lines can reveal its effects on:

    • Autophagy processes

    • Cell viability and proliferation (measured by CCK-8 assay and Edu staining)

    • Cell invasion and migration (assessed via Transwell and wound healing assays)

    • Apoptosis (quantified through flow cytometry)

  • Pathway analysis: Investigating NRSN2's interaction with the AMPK/ULK1 pathway provides mechanistic insights into how it influences autophagy in cancer cells. This can be accomplished through:

    • Monitoring autophagosome formation via transmission electron microscopy (TEM)

    • Assessing pathway activation through phosphorylation status of key components

    • Using pathway inhibitors to confirm mechanistic relationships

  • Overexpression studies: Comparing the effects of NRSN2 overexpression in different cancer cell lines can help identify context-dependent functions and potential therapeutic vulnerabilities .

What are the critical controls needed when studying Neurensin-2 expression and function?

When designing experiments to investigate Neurensin-2, researchers should implement these essential controls:

  • Antibody validation controls:

    • Use Neurensin-2 knockout tissues as negative controls to confirm antibody specificity

    • Include paralog controls (e.g., Neurensin-1) to demonstrate specificity between related proteins

    • Validate with multiple antibodies targeting different epitopes when possible

  • Gene expression controls:

    • Use appropriate housekeeping genes for qPCR normalization

    • Include cell-type-specific marker genes when analyzing sorted populations

    • Validate RNA-seq findings with qPCR on independent samples

  • Functional study controls:

    • Include both gain-of-function and loss-of-function approaches

    • Implement rescue experiments to confirm specificity of observed phenotypes

    • Use appropriate wild-type littermates as controls for genetic models

  • Behavioral study controls:

    • Employ multiple behavioral paradigms to assess consistent phenotypes

    • Control for confounding factors like locomotor activity when interpreting emotional behaviors

    • Include positive controls (e.g., known antidepressant treatments) in stress studies

How can researchers distinguish between direct and indirect effects of Neurensin-2 manipulation?

Determining whether observed phenotypes result directly from Neurensin-2 alterations or from downstream effects requires careful experimental design:

  • Temporal control systems:

    • Inducible expression or knockout systems can help establish causality by controlling the timing of Neurensin-2 manipulation

    • Acute versus chronic manipulation comparisons can reveal adaptive responses

  • Cell-type-specific approaches:

    • Use Cre-dependent manipulation restricted to specific neuronal populations

    • Compare effects across different cell types where Neurensin-2 is normally expressed

    • Correlate phenotype severity with expression levels in different cell populations

  • Molecular pathway dissection:

    • Simultaneously manipulate downstream effectors to determine if they can rescue or prevent Neurensin-2-mediated effects

    • Use pharmacological tools to target specific pathways potentially affected by Neurensin-2

    • Perform comprehensive transcriptomic/proteomic analyses at multiple timepoints following Neurensin-2 manipulation

What are the most common technical challenges in Neurensin-2 research and how can they be addressed?

Researchers working with Neurensin-2 frequently encounter these technical challenges:

  • Detection sensitivity limitations:

    • Use amplification methods for low-abundance detection

    • Employ cell-type enrichment approaches like TRAP to increase signal

    • Consider using more sensitive detection methods like droplet digital PCR for transcript analysis

  • Cell-type heterogeneity:

    • Implement single-cell approaches to resolve expression in rare cell populations

    • Use FANS combined with cell-type-specific GFP expression to isolate pure populations

    • Apply computational deconvolution methods to bulk tissue data

  • Knockout compensation:

    • Assess potential compensatory upregulation of Neurensin-1 or other related proteins

    • Use acute knockdown approaches alongside constitutive knockouts to identify compensatory mechanisms

    • Perform temporal analysis of gene expression following Neurensin-2 manipulation

  • Reconciling contradictory findings:

    • Consider brain region-specific effects (hippocampus vs. amygdala vs. habenula)

    • Examine sex-specific differences that might explain divergent results

    • Evaluate the influence of background strain in different mouse models

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.