Recombinant Mouse Neuromedin-B receptor (Nmbr)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Expression

Recombinant Mouse NMBR is a 390-amino acid protein with a molecular weight of ~80 kDa. It features seven transmembrane domains characteristic of GPCRs and is encoded by the NMBR gene (NP_032729) . Key structural elements include:

  • Ligand-binding specificity: High affinity for NMB over gastrin-releasing peptide (GRP) .

  • Post-translational modifications: Glycosylation sites in extracellular domains, critical for receptor trafficking .

Table 1: Key Molecular Features

PropertyDetails
Amino acids390
Molecular weight80 kDa
Transmembrane domains7
GPCR familyBombesin receptor subfamily 1
Chromosomal locationMouse Chr 15; Human Chr 6q14.1

Signaling Pathways

NMBR activation triggers:

  1. Gq protein coupling: Leading to phospholipase C activation and intracellular Ca²⁺ mobilization .

  2. Downstream kinases: AMP-activated protein kinase (AMPK) and protein kinase A (PKA) pathways, enhancing Cav3.2 T-type Ca²⁺ channel activity in sensory neurons .

  3. Cross-talk with immune responses: Upregulation during H1N1 influenza infection enhances IFN-α production while suppressing IL-6 .

Cellular Effects

  • Neuronal hyperexcitability: Mediates pain hypersensitivity via Cav3.2 channel potentiation in trigeminal ganglia .

  • Respiratory control: Nmb-expressing neurons in the retrotrapezoid nucleus regulate CO₂/pH sensitivity .

  • Reproductive modulation: Stimulates testosterone synthesis in Leydig cells through STAR and CYP11A1 upregulation .

Experimental Models

  • VersaClone cDNA systems: Used for heterologous expression in mammalian cells to study receptor pharmacology .

  • Knockout mice: NMBR-deficient models reveal compensatory mechanisms in thermoregulation and nociception .

Therapeutic Insights

  • Pain management: T-type channel blockade attenuates NMBR-induced mechanical hypersensitivity .

  • Antiviral strategies: NMBR activation reduces H1N1 viral load by 60% in murine models .

  • Respiratory disorders: Ablation of RTN Nmb neurons causes alveolar hypoventilation and sleep-disordered breathing .

Expression and Distribution

  • Central nervous system: Olfactory regions, thalamus, and brainstem .

  • Peripheral tissues: Testes, gastrointestinal smooth muscle, and endocrine glands .

Technical Considerations

  • Antibody validation: Commercial clones (e.g., R&D Systems) require verification via shRNA knockdown in TG neurons .

  • Pharmacological tools: BIM23042 (NMBR antagonist) and QEHA peptide (Gβγ inhibitor) are key for pathway dissection .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Nmbr; Neuromedin-B receptor; NMB-R; Neuromedin-B-preferring bombesin receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-390
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MPPRSLSNLSFPTEANESELVPEVWEKDFLPDSDGTTAELVIRCVIPSLYLIIISVGLLG NIMLVKIFLTNSAMRNVPNIFISNLAAGDLLLLLTCVPVDASRYFFDEWVFGKLGCKLIP AIQLTSVGVSVFTLTALSADRYRAIVNPMDMQTSGVLLWTSLKAVGIWVVSVLLAVPEAV FSEVARIGSLDNSSFTACIPYPQTDELHPKIHSVLIFLVYFLIPLVIISIYYYHIAKTLI KSAHNLPGEYNEHTKKQMETRKRLAKIVLVFVGCFVFCWFPNHVLYLYRSFNYKEIDPSL GHMIVTLVARVLSFSNSCVNPFALYLLSESFRKHFNSQLCCGRKSYPERSTSYLLSSSAV RMTSLKSNTKNVVTNSVLLNGHSTKQEIAL
Uniprot No.

Target Background

Function
Receptor for neuromedin-B.
Gene References Into Functions
  1. Neuromedin B expression identifies retrotrapezoid nucleus neurons in the mouse. PMID: 29066557
  2. NMB or NMBR silencing inhibited M-CSF/c-Fms-mediated downstream signaling pathways, including ERK and Akt activation and induction of cyclin D1 and D2. PMID: 28780306
  3. Mice with NB receptor deletion exhibit lower insulinemia, particularly in response to oral glucose. Females also demonstrate improved glucose tolerance, suggesting neuromedin B and its receptor's role in regulating incretin-induced insulin secretion and insulin sensitivity. PMID: 27756093
  4. Ablation of NMB receptor-expressing neurons eliminated basal and hypoxia-induced sighing without initially affecting other breathing patterns. PMID: 26855425
  5. Neuromedin B pathways are significantly involved in TSH secretory pathways, regulating in vivo gene expression of TSH beta-subunit, pituitary MCT8 and Thrb, and hypothalamic TRH and type 2 deiodinase. PMID: 25454367
  6. This research defines the roles of NMBR and GRPR in itch transmission and reveals a relationship between these two receptors and their respective interneuron populations in itch signaling. PMID: 25209280
  7. Spinal GRPr and NMBr independently drive itch neurotransmission in mice. PMID: 23826298
  8. Findings suggest NMB's involvement in cartilage development, either autocrine or paracrine. PMID: 22652580
  9. NMBR mRNA and protein expression peaks at the onset of labor. PMID: 19587437
  10. Disruption of the neuromedin B receptor pathway did not alter body weight homeostasis in female mice fed a normolipid diet. PMID: 20211980
  11. NMB-R-deficient mice showed decreased behavior in both the L-D box and elevated plus maze tests. PMID: 11803457
  12. Elevated 5-HT expression in the dorsal raphe (DR) nucleus is observed in NMB-R-deficient mice, suggesting NMB/NMB-R modulation of 5-HT neuronal activity through DR function. PMID: 12031854
  13. Impaired memory in stressed neuromedin B receptor-deficient mice is not attributed to changes in activity, anxiety, or pain response. The NMB/NMB-R pathway may regulate stress response via the neural system controlling learning and memory. PMID: 12576129
  14. NMBR and BRS-3 genes were expressed from embryonic days 13-16 and on multiple postnatal days in the lungs. PMID: 12959933
  15. NMBR selectivity for neuromedin B over the gastrin-releasing peptide receptor primarily depends on amino acid differences in the third extracellular domains and the adjacent upper fifth transmembrane region of the two receptors. PMID: 19628633
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Neuromedin-B receptor (Nmbr) and what is its biological significance?

Neuromedin B receptor (Nmbr) is a G protein-coupled receptor that binds specifically to Neuromedin B (NMB), a bombesin-like peptide. The receptor-ligand system performs various physiological functions across mammals, with particularly important roles in central nervous system signaling and peripheral tissue regulation . Structurally, mouse Nmbr contains one open reading frame (ORF) of 1,173 bp that encodes 390 amino acids, featuring characteristic transmembrane domains that are highly conserved across species including humans, mice, rats, and cows .

The biological significance of Nmbr extends to multiple systems, most notably:

  • Respiratory control mechanisms, particularly CO₂ chemoreception

  • Energy homeostasis and metabolic regulation

  • Mitochondrial function in skeletal muscle

  • Sleep regulation and stability

Research methodologies targeting Nmbr typically involve transgenic approaches (Nmbr-Cre or Nmbr-KO models), receptor binding assays, and functional studies examining downstream signaling cascades.

How is the Nmbr gene expressed across different mouse tissues?

Neuromedin B receptor shows a distinct tissue distribution pattern that differs significantly from its ligand. While NMB is predominantly expressed in the central nervous system (CNS), Nmbr demonstrates higher expression in peripheral tissues and organs . This differential expression pattern suggests tissue-specific functional roles.

Specifically, research has shown:

  • Nmbr mRNA is highly expressed in peripheral tissues including endocrine glands, reproductive organs, and skeletal muscle

  • The retrotrapezoid nucleus (RTN) contains a significant population of Nmbr-expressing neurons critical for respiratory chemoreception

  • Sexual dimorphism exists in Nmbr expression patterns, with female mice showing higher levels of Nmbr mRNA in skeletal muscle compared to males

For tissue expression studies, quantitative real-time PCR (qPCR) using specific primers is the recommended approach. Based on validated research protocols, the following primers have been successfully employed for mouse Nmbr detection:

Forward primer: 5'-CTGGTCCACAGCAACACA-3'
Reverse primer: 5'-GCCATCCAGCTCACCTC-3'

What physiological processes are regulated by Nmbr in mouse models?

Nmbr regulates several critical physiological processes that have been elucidated through both genetic and pharmacological manipulation studies. The most well-established functions include:

Respiratory control: Nmbr-expressing neurons in the retrotrapezoid nucleus (RTN) are essential for the hypercapnic ventilatory response and maintenance of respiratory homeostasis. These neurons specifically mediate the respiratory effects of arterial PCO₂/pH changes .

Energy metabolism: Nmbr signaling influences whole-body energy expenditure. Female Nmbr-knockout mice demonstrate resistance to diet-induced obesity without hyperphagia, indicating a potential role in regulating energy utilization rather than intake .

Mitochondrial function: In skeletal muscle, particularly in glycolytic muscle fibers, Nmbr signaling appears to regulate mitochondrial oxidative phosphorylation capacity. Disruption of Nmbr improves mitochondrial function in this tissue type .

Sleep regulation: RTN Nmbr neurons contribute to breathing stability during sleep, with their ablation resulting in profound breathing instability and sleep disruption, suggesting potential implications for sleep-disordered breathing research .

What are the consequences of selective ablation of Nmbr-expressing neurons in the retrotrapezoid nucleus?

Selective ablation of approximately 95% of Nmbr-expressing neurons in the retrotrapezoid nucleus (RTN) produces profound physiological consequences that reveal their essential role in respiratory homeostasis. Research employing transgenic Nmb-Cre mice with Cre-dependent cell ablation techniques has demonstrated that RTN Nmb neurons are critical for CO₂-dependent drive to breathe .

The consequences of this selective ablation include:

  • Compensated respiratory acidosis: Due to alveolar hypoventilation, indicating impaired baseline respiratory drive

  • Profound breathing instability: Characterized by irregular breathing patterns and increased variability in respiratory parameters

  • Respiratory-related sleep disruption: Suggesting a critical role in maintaining stable breathing during sleep states

  • Resting hypoxemia: Following RTN Nmb lesion, mice exhibit reduced blood oxygen levels at rest

  • Severe apnea during hyperoxia: Indicating that oxygen-sensitive mechanisms (likely peripheral chemoreceptors) normally compensate for the loss of RTN Nmb neurons

  • Complete loss of hypercapnic ventilatory response: While behavioral responses to CO₂ (freezing and avoidance) remain intact

These findings strongly suggest that RTN Nmb neurons are specifically dedicated to the respiratory effects of arterial PCO₂/pH and maintain respiratory homeostasis under normal conditions. The preservation of hypoxic ventilatory responses and CO₂-evoked behaviors indicates that Nmb neurons have a selective role in respiratory chemoreception rather than a broader role in all gas-sensing mechanisms.

How does disruption of Nmbr affect mitochondrial function in skeletal muscle?

The disruption of neuromedin B receptor (Nmbr) in skeletal muscle leads to significant improvements in mitochondrial function, particularly in oxidative phosphorylation capacity. This relationship was established through comprehensive studies of Nmbr-knockout (NBR-KO) mice using high-resolution respirometry and molecular analyses .

Key findings regarding Nmbr disruption and mitochondrial function include:

  • Enhanced oxidative profile: Female NBR-KO gastrocnemius muscle showed increased expression of Myh7 mRNA, which is characteristic of type I muscle fibers with an oxidative metabolic profile

  • Increased oxygen consumption coupled to ATP synthesis: Permeabilized gastrocnemius fibers from NBR-KO mice exhibited higher oxygen consumption specifically linked to ATP production

  • Elevated ATP synthase levels: Protein analysis revealed higher levels of ATP synthase in NBR-KO gastrocnemius

  • Upregulation of mitochondrial complex I components: NBR-KO gastrocnemius had higher Nduf9 mRNA levels, corresponding to mitochondrial complex I subunit

  • Structural changes: Electron microscopy revealed increased Z-line thickness and slight increases in mitochondrial number in NBR-KO muscle

Conversely, direct treatment of L6 myocytes with neuromedin B (5 μg/mL for 16 hours) decreased oxygen consumption coupled to ATP synthesis, providing further evidence for direct action of the NB-NBR signaling pathway on skeletal muscle cells .

These findings suggest that inhibition of NB-NBR signaling enhances the capacity for oxidative phosphorylation in predominantly glycolytic skeletal muscle, which may contribute to the resistance to diet-induced obesity observed in female NBR-KO mice.

What sex-specific differences exist in Nmbr expression and function?

Research has revealed significant sexual dimorphism in both the expression patterns and functional effects of neuromedin B receptor (Nmbr) in mice. These sex-specific differences have important implications for experimental design and interpretation of results in Nmbr research .

Key sex-specific differences include:

Expression patterns:

  • Female wild-type mice express higher levels of both Nmbr and Nmb mRNA in skeletal muscle compared to males

  • This differential expression suggests sex-specific regulation of the NB-NBR signaling pathway

Metabolic effects:

  • Female NBR-knockout (NBR-KO) mice exhibit resistance to diet-induced obesity without hyperphagia

  • This phenotype suggests sex-specific effects on energy expenditure regulation

Mitochondrial function:

  • The enhancement of mitochondrial oxidative phosphorylation capacity following Nmbr disruption has been primarily characterized in female mice

  • Whether male NBR-KO mice exhibit similar improvements in mitochondrial function remains to be fully elucidated

From a methodological perspective, these sex differences highlight the importance of:

  • Including both male and female animals in Nmbr research studies

  • Analyzing and reporting data separately by sex

  • Considering hormonal influences on Nmbr expression and function

  • Investigating potential estrogen/androgen response elements in Nmbr gene regulation

What are the optimal protocols for genotyping Nmbr-knockout mice?

Accurate genotyping of Nmbr-knockout (NBR-KO) mice is essential for proper experimental design and interpretation. Based on established research protocols, the following polymerase chain reaction (PCR) approach is recommended :

Sample collection and DNA extraction:

  • Collect tissue samples (typically tail snips or ear punches) from mice at weaning age

  • Extract genomic DNA using standard commercial kits or phenol-chloroform extraction protocols

  • Ensure DNA quality and concentration are sufficient for PCR amplification

PCR protocol:

  • Use primers specifically designed to detect both the normal allele and the disrupted Nmbr gene

  • Follow the primer sequences as described in original research that reported the generation of NBR-KO mice

  • Include both positive controls (known heterozygous or homozygous samples) and negative controls (no template) in each PCR run

Gel electrophoresis and interpretation:

  • The absence of the normal allele band on agarose gel confirms successful Nmbr gene disruption

  • Heterozygous animals will show bands corresponding to both the normal and disrupted alleles

  • Wild-type littermates will show only the normal allele band

Confirmation of knockout at the mRNA level:

  • For comprehensive genotype verification, RT-PCR analysis of Nmbr mRNA expression in relevant tissues can be performed

  • The complete absence of normal Nmbr mRNA transcript in skeletal muscle or other high-expressing tissues confirms successful knockout

This genotyping protocol ensures accurate identification of Nmbr-knockout mice for subsequent experimental studies.

What techniques are most effective for analyzing Nmbr expression at the mRNA and protein levels?

Multiple complementary techniques can be employed to effectively analyze Nmbr expression at both mRNA and protein levels in research contexts. Based on published methodologies, the following approaches are recommended:

mRNA expression analysis:

  • Quantitative real-time PCR (qPCR):

    • Extract RNA using appropriate methods (TRIzol extraction followed by column purification has proven effective)

    • Synthesize cDNA using standard reverse transcription protocols (e.g., High-Capacity cDNA Reverse Transcription kit)

    • Use appropriate reference genes (e.g., Gapdh, Rplp0, or Tbp) for normalization

  • In situ hybridization:

    • Particularly useful for localizing Nmbr expression in specific cell populations within tissues

    • RNAscope technology provides enhanced sensitivity for low-abundance transcripts

Protein expression analysis:

  • Immunohistochemistry (IHC):

    • The avidin-biotin-peroxidase complex (ABC) method has been successfully employed

    • Protocol overview:

      • Pretreat sections with 0.1 M PBS (5 min)

      • Quench endogenous peroxidases with methanol containing 0.3% hydrogen peroxide (10 min)

      • Block with 5% normal serum (30 min)

      • Incubate with primary antisera (e.g., goat anti-NMBR polyclonal antibody, diluted 1:50) at 4°C overnight

      • Incubate with biotinylated secondary antibody (30 min)

      • Incubate with streptavidin-biotin complex (30 min)

      • Develop with appropriate chromogen

  • Western blotting:

    • Particularly useful for quantifying total Nmbr protein levels

    • Requires validation of antibody specificity using Nmbr-knockout tissues as negative controls

Each technique offers distinct advantages, and combining multiple approaches provides the most comprehensive analysis of Nmbr expression.

How can researchers effectively study Nmbr-mediated signaling pathways in vitro?

Effective investigation of Nmbr-mediated signaling pathways in vitro requires careful consideration of cell models, stimulation protocols, and downstream analysis techniques. Based on established research approaches, the following methodology is recommended:

Cell models:

  • L6 myoblast cell line:

    • A well-established model for studying skeletal muscle biology

    • Maintenance protocol:

      • Culture in DMEM high glucose supplemented with 10% FBS, 2 mmol/L glutamine, and 100 nmol/L sodium selenite

      • Maintain under 70% confluency for undifferentiated state

      • For differentiation into myocytes, reduce FBS to 2% when cells reach confluence

      • Study cells on day 8 of differentiation

  • Primary neuronal cultures:

    • Particularly relevant for studying Nmbr in respiratory chemoreceptor neurons

    • Isolation from specific brain regions (e.g., retrotrapezoid nucleus) requires specialized techniques

Stimulation protocols:

  • Neuromedin B treatment:

    • Dose: 5 μg/mL has been demonstrated to affect mitochondrial function in L6 myocytes

    • Duration: 16 hours incubation has shown significant effects on oxygen consumption

    • Include appropriate vehicle controls

  • Antagonist studies:

    • Selective Nmbr antagonists can be employed to confirm receptor specificity

    • Dose-response experiments should be conducted to establish optimal concentrations

Downstream analysis techniques:

  • Mitochondrial function assessment:

    • High-resolution respirometry to measure oxygen consumption

    • Analysis of ATP synthesis capacity

    • Assessment of mitochondrial membrane potential

  • Signal transduction analysis:

    • Western blotting for phosphorylated signaling proteins

    • Calcium imaging to assess intracellular calcium dynamics

    • cAMP assays to evaluate Gs-protein coupled signaling

  • Gene expression analysis:

    • qPCR for target genes downstream of Nmbr activation

    • RNA-seq for unbiased transcriptomic profiling

For reproducibility, cell-based results should be obtained from at least three independent experiments conducted on different days with cells from different cultivation batches .

What are the potential implications of Nmbr research for understanding sleep-disordered breathing?

Research on neuromedin B receptor (Nmbr) has revealed significant potential implications for understanding the pathophysiology of sleep-disordered breathing conditions. Studies of Nmbr-expressing neurons in the retrotrapezoid nucleus (RTN) provide compelling evidence for their role in respiratory stability during sleep .

Key findings with implications for sleep-disordered breathing include:

  • Respiratory instability following RTN Nmbr neuron ablation: Selective ablation of RTN Nmbr neurons causes profound breathing instability and respiratory-related sleep disruption in mice

  • Correlation with sleep apnea characteristics: The phenotype observed in mice following RTN Nmbr neuron ablation shares similarities with human sleep apnea, including unstable breathing patterns and sleep fragmentation

  • Compensatory mechanisms: Following RTN Nmbr lesions, mice become hypoxemic at rest and are prone to severe apneas during hyperoxia, suggesting oxygen-sensitive compensatory mechanisms that may be relevant to understanding periodic breathing patterns in sleep apnea

  • Role in CO₂ chemosensitivity: RTN Nmbr neurons are critical for the hypercapnic ventilatory response, which is fundamental to respiratory stability during sleep

Research suggests that malfunction of RTN Nmbr neurons could underlie the etiology of certain forms of sleep-disordered breathing in humans . This hypothesis opens several research directions:

  • Investigation of genetic variants in NMBR and their association with sleep apnea risk

  • Development of targeted therapies to modulate Nmbr neuronal activity to stabilize breathing in sleep disorders

  • Exploration of the intersection between Nmbr signaling and other established factors in sleep apnea pathophysiology

How might Nmbr signaling be targeted for metabolic research?

The discovery that disruption of neuromedin B receptor (Nmbr) improves mitochondrial oxidative phosphorylation in skeletal muscle and confers resistance to diet-induced obesity in female mice has significant implications for metabolic research . This finding positions Nmbr as a potential therapeutic target for obesity and related metabolic disorders.

Key research areas for targeting Nmbr signaling in metabolic studies include:

Mechanistic investigations:

  • Detailed characterization of the signaling pathways through which Nmbr regulates mitochondrial function

  • Exploration of the tissue-specific effects of Nmbr signaling on energy expenditure

  • Investigation of sex-specific regulatory mechanisms that explain the more pronounced effects in females

Therapeutic development approaches:

  • Screening for selective Nmbr antagonists that could mimic the beneficial metabolic effects of genetic Nmbr disruption

  • Development of tissue-specific Nmbr targeting strategies to minimize potential side effects

  • Exploration of combination therapies targeting multiple aspects of energy regulation

Translational research opportunities:

  • Investigation of NMBR expression and function in human skeletal muscle samples from individuals with varying metabolic health

  • Examination of NMBR genetic variants and their association with obesity susceptibility

  • Metabolomic profiling to identify downstream metabolic pathways affected by Nmbr signaling

The findings that female NBR-KO mice exhibit resistance to diet-induced obesity without hyperphagia and show enhanced mitochondrial oxidative phosphorylation in skeletal muscle suggest that inhibition of NB-NBR signaling could be a novel approach for developing anti-obesity therapeutics . Future studies should focus on clarifying the contribution of different muscle types to whole-body energy expenditure and the potential differential effects in males versus females.

What are the current technical challenges in studying recombinant mouse Nmbr?

Despite significant advances in Nmbr research, several technical challenges remain that limit our comprehensive understanding of this receptor system. Researchers should be aware of these challenges when designing experiments and interpreting results.

Antibody specificity and availability:

  • Limited availability of highly specific antibodies for mouse Nmbr

  • Potential cross-reactivity with other bombesin-like peptide receptors

  • Need for thorough validation of antibodies using Nmbr-knockout tissues as negative controls

Tissue-specific knockout models:

  • Current models primarily employ global Nmbr knockout approaches

  • Development of conditional, tissue-specific Nmbr knockout models would enable more precise mechanistic studies

  • Technical difficulties in generating cell type-specific promoters for targeting specific Nmbr-expressing populations

Functional redundancy:

  • Potential compensatory mechanisms through other bombesin-like peptide receptors

  • Challenge of dissecting specific Nmbr functions from redundant signaling pathways

  • Need for combinatorial receptor knockout approaches

Translation to human studies:

  • Species differences in Nmbr distribution and function

  • Ethical limitations in studying NMBR in human central nervous system tissues

  • Challenges in developing selective NMBR modulators with appropriate pharmacokinetic properties

Recommended methodological approaches to address these challenges include:

  • Combined use of genetic, pharmacological, and molecular approaches to corroborate findings

  • Development of improved tools for studying Nmbr (e.g., better antibodies, selective agonists/antagonists)

  • Interdisciplinary collaboration between neuroscientists, endocrinologists, and respiratory physiologists to comprehensively characterize Nmbr functions

Gene and protein information for mouse Nmbr

ParameterDetailsReference
Gene symbolNmbr
Open reading frame (ORF)1,173 bp
Protein length390 amino acids
Key structural featuresMultiple transmembrane domains
ConservationHigh homology across species (pig, human, mouse, rat, cow)
Primary ligandNeuromedin B (NMB)

Primer sequences for mouse Nmbr and related gene expression analysis

GeneForward Primer (5'-3')Reverse Primer (5'-3')Reference
NmbrCTGGTCCACAGCAACACAGCCATCCAGCTCACCTC
NmbGCAGATCATGACTCAGCTGTAGCAAGATTCGAGTGCACCCT
Myh7ACTGTCAACACTAAGAGGGTCATTGGATGATTTGATCTTCCAGGG
Ndufa9TTCTGTGGCTCATCCCATCGCCCATTCGTCCAAGGTGGTT
Ppargc1aACTGAGCTACCCTTGGGATGTAAGGATTTCGGTGGTGACA

Physiological effects of Nmbr manipulation in research models

ParameterEffect of Nmbr Knockout/AblationTissue/SystemReference
Respiratory chemosensitivityComplete loss of hypercapnic ventilatory responseCentral respiratory control
Respiratory stabilityProfound breathing instability and sleep disruptionRespiratory system
Mitochondrial functionImproved oxidative phosphorylation capacitySkeletal muscle
Obesity susceptibilityResistance to diet-induced obesity (in females)Whole-body metabolism
Muscle fiber typeIncreased expression of oxidative fiber markersSkeletal muscle
Behavioral CO₂ responsesPreserved freezing and avoidance behaviorsBehavioral responses

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.