Recombinant Mouse Neuromedin-K receptor (Tacr3)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Significance

Recombinant Mouse Neuromedin-K receptor (Tacr3) is a laboratory-generated form of the tachykinin receptor 3 protein, designed for experimental studies of neurokinin B (NKB) signaling. Tacr3 is a G protein-coupled receptor (GPCR) that binds NKB with high affinity, modulating synaptic plasticity, sex hormone regulation, and anxiety-related behaviors . Its recombinant form enables mechanistic studies of ligand-receptor interactions, structural analyses, and therapeutic target validation.

Protein Characteristics

PropertyDetails
Gene NameTacr3 (Mus musculus)
UniProt IDP47937
Amino Acid Length452 residues (full-length native protein)
Domains7 transmembrane helices, extracellular N-terminus, intracellular C-terminus
Post-Translational ModificationsGlycosylation, palmitoylation
Recombinant ConstructsPartial sequences (e.g., extracellular domains) fused with tags (His, Avi)

Biochemical Functions

FunctionMechanism/Associated Pathways
Tachykinin bindingBinds NKB > neurokinin A > substance P
Signal transductionActivates Gq/11 → phospholipase C → calcium release
Synaptic modulationRegulates CaMKII activation, AMPA receptor phosphorylation
Hormonal regulationLinked to testosterone production and GnRH neuron activity

Expression Systems

Recombinant Tacr3 is produced in multiple host systems to suit experimental needs:

Host SystemAdvantagesExample Products
E. coliCost-effective, high yieldCSB-EP023070MO1 (Cusabio)
Baculovirus/Insect CellsProper folding for membrane proteinsMBS1278669 (MyBioSource)
Mammalian CellsNative post-translational modificationsCSB-MP023070MO1 (Cusabio)

Quality Control Metrics

  • Purity: ≥85% by SDS-PAGE

  • Activity Validations: Ligand-binding assays (e.g., radiolabeled NKB displacement)

  • Applications: Western blot (WB), ELISA, immunohistochemistry (IHC)

Key Studies Using Recombinant Tacr3

  1. Reproductive Neuroendocrinology

    • Tacr3-deficient mice exhibit subfertility due to disrupted GnRH release, mimicking human hypogonadotropic hypogonadism . Recombinant Tacr3 aids in identifying rescue mechanisms via testosterone supplementation .

  2. Anxiety and Synaptic Plasticity

    • Ventral hippocampal Tacr3 downregulation correlates with anxiety-like behaviors in rats. Recombinant protein studies reveal its role in spine density regulation and CaMKII hyperactivation .

  3. Ligand Binding Profiling

    • Competitive binding assays with recombinant Tacr3 confirm its affinity hierarchy: NKB > neurokinin A > substance P .

Challenges in Production

  • Membrane Protein Solubility: Requires detergents (e.g., CHAPS) for extraction .

  • Tag Interference: His/Avi tags may affect ligand-binding kinetics; tag-free constructs are preferred for functional assays .

Validation Protocols

  • Western Blot: Anti-Tacr3 antibodies (e.g., Rabbit pAb, 1:1,000 dilution) .

  • Functional Assays: Calcium flux measurements in HEK293 cells transiently transfected with recombinant Tacr3 .

Future Directions

  • Therapeutic Targeting: Small-molecule antagonists (e.g., osanetant) show promise for anxiety disorders .

  • Structural Biology: Cryo-EM studies using recombinant Tacr3 could reveal binding pockets for drug design .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate your specific format requirements. Please indicate your preferred format when placing your order, and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Tacr3; Tac3r; Neuromedin-K receptor; NKR; NK-3 receptor; NK-3R; Neurokinin B receptor; Tachykinin receptor 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-452
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MASVPTGENWTDGTAGVGSHTGNLSAALGITEWLALQAGNFSSALGLPVTSQAPSQVRAN LTNQFVQPSWRIALWSLAYGLVVAVAVFGNLIVIWIILAHKRMRTVTNYFLVNLAFSDAS VAAFNTLVNFIYGVHSEWYFGANYCRFQNFFPITAVFASIYSMTAIAVDRYMAIIDPLKP RLSATATKIVIGSIWILAFLLAFPQCLYSKIKVMPGRTLCYVQWPEGPKQHFTYHIIVII LVYCFPLLIMGVTYTIVGITLWGGEIPGDTCDKYHEQLKAKRKVVKMMIIVVVTFAICWL PYHVYFILTAIYQQLNRWKYIQQVYLASFWLAMSSTMYNPIIYCCLNKRFRAGFKRAFRW CPFIQVSSYDELELKTTRFHPTRQSSLYTVSRMESVTVLYDPSEGDPAKSSRKKRAVPRD PSANGCSHREFKSASTTSSFISSPYTSVDEYS
Uniprot No.

Target Background

Function
This receptor serves as a binding site for the tachykinin neuropeptide neuromedin-K (neurokinin B). It is associated with G proteins that activate a phosphatidylinositol-calcium second messenger system.
Gene References Into Functions

Key Research Findings on Neurokinin 3 Receptor (NK3R):

  1. Data suggests that NK3R could be a potential target for anti-angiogenesis therapies. PMID: 28489574
  2. NKB-NK3R signaling plays a significant role in pubertal maturation. Alterations in this signaling pathway might contribute to pubertal disorders linked to metabolic stress and negative energy balance. PMID: 22396413
  3. While capable of fertility, Tacr3-deficient mice exhibit central reproductive defects. PMID: 22253416
  4. Neurokinin 3 receptor activation in the median preoptic nucleus modulates body temperature. PMID: 22028440
  5. Tachykinin NK3 receptor genes are expressed in uterine cells, oocytes, ovaries, and embryos from mice, suggesting a potential role in female reproductive function. PMID: 12773411
  6. NK3-receptors are not implicated in the development of lung inflammation or inflammatory cell recruitment into airways of antigen-challenged mice. PMID: 15501700
  7. The co-expression of NK-3R and NMDA/AMPA receptor subunits in the nigral neurons provides a structural basis for functional modulation of neuronal glutamate receptors by neurokinin-3. PMID: 16038885
  8. In neurokinin 1 receptor knockout retinas, no significant changes were observed: neurokinin 3 receptor mRNA levels and substance P and neurokinin 3 receptor immunostainings were similar to wild types. PMID: 16388914
  9. Studies suggest a potential role for NK3 in learning and memory. PMID: 17558564
  10. These findings support a role for the NK(3) receptor in operant task performance and spatial learning, but not in working memory. PMID: 18351324
  11. Collectively, these results suggest a role for the NK3 receptor in reactivity to dopaminergic stimuli. However, the lack of robust changes indicates that the sensitivity to dopamine may be activity-dependent or benign in nature. PMID: 18690106
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the Tacr3 receptor and what is its primary ligand?

TACR3 is a member of the tachykinin receptor family belonging to the rhodopsin subfamily of G protein-coupled receptors. It primarily responds to neurokinin B (NKB), which serves as its high-affinity ligand . The receptor is widely distributed in the mammalian central nervous system, particularly in the cortex, amygdala, hippocampus, and midbrain regions . Unlike other tachykinin receptors that may respond to multiple tachykinins, TACR3 shows relatively specific binding to neurokinin B, making it an important target for selective modulation in experimental settings.

How does TACR3 expression vary across developmental stages and brain regions?

TACR3 expression exhibits significant developmental and regional variation. In male rats, sexual development is associated with a substantial increase in hippocampal TACR3 expression, which coincides with elevated serum testosterone levels . The ventral hippocampus shows particularly dynamic expression patterns related to physiological states. Expression levels also fluctuate throughout the estrous cycle in female rats, indicating sensitivity to sex hormone regulation . When designing experiments involving TACR3, researchers should account for these variables by carefully selecting age-matched subjects and considering the estrous cycle stage in female animals to minimize confounding factors.

What are the recommended methods for measuring TACR3 protein expression in tissue samples?

For reliable quantification of TACR3 protein expression, Western blotting of tissue lysates from specific brain regions (particularly the hippocampus) provides quantitative data . Tissue should be rapidly extracted and lysed by sonication to preserve protein integrity. Immunohistochemistry and immunofluorescence analysis can provide spatial distribution information, as demonstrated in studies examining TACR3 in clinical samples . For cellular localization studies, it's important to note that TACR3 is predominantly expressed in the cell membrane, including the presynaptic compartment . When comparing expression across experimental conditions, normalizing to established housekeeping proteins and including positive control tissues with known expression patterns is recommended.

What are effective pharmacological tools for modulating TACR3 activity in experimental settings?

Osanetant is a widely used selective TACR3 antagonist that effectively inhibits receptor activity in experimental settings. For in vivo administration protocols, osanetant can be prepared from stock solutions diluted in DMSO and further diluted in 0.9% sterile saline. Administration via intraperitoneal injection at a dose of 5 mg/kg has been shown to be effective . For direct central administration, cannula implantation followed by infusion through osmotic minipumps can deliver sustained antagonist exposure. When designing such experiments, proper vehicle controls (using the same volume of saline with equivalent DMSO content) should be included, and post-surgical pain management using long-acting analgesics like Buprenorphine (0.65 mg/kg) is recommended .

How should researchers design experiments to study TACR3's role in anxiety-related behaviors?

When investigating TACR3's role in anxiety, experimental design should incorporate multiple validated anxiety assessment paradigms rather than relying on a single test. Effective protocols include elevated plus maze, open field test, and light-dark exploration tests, with parameters carefully defined to distinguish anxiety from general locomotor changes. Stratification of subjects based on baseline anxiety levels (such as categorizing into Severe Anxiety and Moderate Anxiety groups) can reveal important differences in TACR3 expression and function . Gene expression analysis using RNA extracted from the ventral hippocampus can then be performed between these groups, defining differentially expressed genes with absolute log-fold change above 1 and P value < 0.05 . Gene ontology and pathway analysis should follow to contextualize TACR3 within broader anxiety-related mechanisms.

What methods are recommended for manipulating TACR3 expression in specific brain regions?

For region-specific manipulation of TACR3 expression, stereotactic delivery of viral vectors (such as AAV) carrying functional or defective TACR3 constructs provides precise spatial control. When targeting the hippocampus, coordinates should be carefully selected based on a standard stereotactic atlas and verified through post-experimental histology. For reversible modulation, osmotic minipumps connected to intracerebroventricular (i.c.v.) cannula can deliver TACR3 antagonists like osanetant directly to specific brain regions . Following surgical procedures, a recovery period of at least 10 days is recommended before behavioral testing . To validate manipulation efficacy, ex vivo tissue analysis combining protein quantification with functional assessments is essential for interpreting subsequent behavioral or physiological outcomes.

How does TACR3 modulation affect synaptic plasticity in the hippocampus?

TACR3 modulation significantly influences synaptic plasticity through multiple mechanisms. Inhibition of TACR3 activity leads to hyperactivation of CaMKII and enhanced AMPA receptor phosphorylation, which are associated with increased spine density . Using multielectrode arrays to assess neuronal activity reveals that TACR3 inhibition results in stronger cross-correlation of firing among neurons, indicating enhanced connectivity . Importantly, the effects of TACR3 on synaptic plasticity are bidirectional: aberrant expression of functional TACR3 in spines results in spine shrinkage and pruning, while defective TACR3 expression increases spine density, size, and the magnitude of cross-correlation between neurons . For comprehensive characterization of these effects, researchers should combine structural analyses (spine morphology) with functional assessments (electrophysiological recordings) and molecular analyses (phosphorylation states of key signaling proteins).

What is the relationship between TACR3 expression levels and anxiety phenotypes?

Severe anxiety has been linked to dampened TACR3 expression specifically in the ventral hippocampus . This relationship appears bidirectional, as TACR3 overexpression in anxiety-relevant brain regions can significantly reverse anxiety-like behaviors . The anxiety-TACR3 relationship is particularly evident in cases of hypogonadism, where low testosterone levels correlate with both reduced TACR3 function and increased anxiety symptoms . When investigating this relationship, researchers should employ comprehensive behavioral test batteries and correlate behaviors with region-specific TACR3 expression levels. Additionally, examining the effects of anxiolytic treatments on TACR3 expression can provide insights into whether TACR3 changes are causative or consequential in anxiety states.

How does TACR3 influence long-term potentiation (LTP) and what methods best capture these effects?

Deficient TACR3 activity impairs long-term potentiation (LTP) in the dentate gyrus, a critical process for learning and memory . The firing pattern in response to LTP induction is inadequate in neurons expressing defective TACR3, suggesting fundamental alterations in synaptic strengthening mechanisms . For investigating these effects, electrophysiological recordings using multielectrode arrays provide valuable insights into neuronal connectivity and synchronization patterns. Field potential recordings in hippocampal slices before and after theta-burst stimulation can quantify LTP magnitude. Importantly, testosterone treatment has been shown to rescue the impaired LTP response in TACR3-deficient neurons , suggesting an interactive pathway that should be considered when designing experiments on synaptic plasticity in the context of TACR3 dysfunction.

How do sex hormones regulate TACR3 expression and function?

Sex hormones, particularly testosterone, exert significant modulatory effects on TACR3 expression. In male rats, testosterone propionate administration (5 mg/kg/day for five consecutive days) significantly increases hippocampal TACR3 expression . In females, TACR3 expression fluctuates during the estrous cycle, further demonstrating hormonal sensitivity . These findings indicate a bidirectional relationship where sex hormones regulate TACR3, and TACR3 function influences sex hormone levels. When investigating this relationship, researchers should consider administering controlled hormone treatments (using subcutaneous injections of testosterone propionate or vehicle) and measure both TACR3 expression changes and circulating hormone levels using appropriate assays, such as competitive immunoassay with direct chemiluminescent technology .

What are the methodological considerations for studying TACR3's role in reproductive development?

When studying TACR3's role in reproductive development, longitudinal experimental designs that span multiple developmental stages are most informative. Sampling from ages ranging from embryonic day 18 (E18) to postnatal day 30 and into adulthood (3-4 months) captures critical developmental transitions . Serum hormone measurements should be collected at multiple timepoints, with careful attention to detection limits (e.g., 0.07 ng/mL for testosterone) . For genetic studies, investigations of TACR3 mutations should consider the well-established link between TAC3/TACR3 mutations and human normosmic hypogonadotropic hypogonadism, a condition characterized by failure of sexual maturation and reproductive dysfunction . Correlative studies examining TACR3 expression, circulating hormone levels, and developmental milestones provide comprehensive insights into the receptor's developmental significance.

What experimental approaches can determine if TACR3 dysfunction directly causes reproductive abnormalities?

To establish causal relationships between TACR3 dysfunction and reproductive abnormalities, conditional knockout or knockdown models with temporal and spatial specificity are most definitive. Comparing phenotypes between global TACR3 knockout and region-specific knockdown (e.g., hypothalamic versus hippocampal) can dissociate direct reproductive effects from indirect consequences. Rescue experiments involving testosterone supplementation in TACR3-deficient animals are particularly informative, as testosterone treatment can ameliorate certain TACR3-related deficits . Monitoring of GnRH release patterns using specialized sampling techniques is essential given TACR3's known modulation of GnRH release at the hypothalamic-pituitary axis . For translational relevance, correlating findings from animal models with clinical observations in patients with TACR3 mutations provides validation of mechanistic insights.

How can researchers effectively study the interplay between TACR3, testosterone, and anxiety mechanisms?

To investigate the complex interplay between TACR3, testosterone, and anxiety, multifactorial experimental designs that manipulate each component independently and in combination are recommended. This approach can include: (1) pharmacological inhibition of TACR3 with osanetant, (2) testosterone supplementation or depletion, and (3) behavioral anxiety assessments . Gene expression analysis using RNA extracted from the ventral hippocampus should examine not only TACR3 itself but also related signaling pathways through GO and KEGG enrichment analysis . Including subjects with varying baseline anxiety levels enhances detection of interaction effects. Importantly, testosterone measurements should be performed before and after interventions using validated assays with appropriate detection thresholds. For mechanistic insights, spine density analysis combined with CaMKII activity and AMPA receptor phosphorylation status provides molecular correlates of anxiety-related neural changes.

What are the recommended approaches for investigating TACR3's potential role in pathological conditions beyond reproductive disorders?

TACR3's expression pattern suggests potential involvement in various pathological conditions beyond reproductive disorders. For investigating TACR3 in cancer biology, the finding that TACR3 is highly expressed in oral squamous cell carcinoma despite being negative in normal epithelium suggests a potential role in tumor progression . Researchers should consider employing tumor models with TACR3 manipulation (overexpression or knockdown) combined with invasion and migration assays. For neuropsychiatric applications, given TACR3's association with anxiety, comparative studies across multiple anxiety-related disorders using postmortem tissue can identify disorder-specific alterations. Single-cell RNA sequencing of relevant brain regions can reveal cell type-specific expression patterns and changes in disease states, providing higher resolution than bulk tissue analysis.

How should researchers design experiments to explore the therapeutic potential of targeting TACR3 for anxiety disorders?

When exploring TACR3 as a therapeutic target for anxiety disorders, research designs should incorporate both preventive and intervention paradigms. For preventive approaches, TACR3 agonists or antagonists can be administered before anxiety-inducing manipulations. For intervention studies, treatments should begin after anxiety phenotypes are established. Dose-response relationships should be carefully characterized, with therapeutic windows defined by both efficacy and side effect profiles. Given the established link between TACR3, sex hormones, and anxiety, sex-specific effects must be explicitly examined, requiring adequate sample sizes of both male and female subjects . Additionally, investigating the combined effects of TACR3-targeted compounds with established anxiolytics can identify potential synergistic therapeutic approaches. Long-term follow-up assessments are essential to determine the durability of therapeutic effects and potential compensatory mechanisms that may emerge with prolonged TACR3 modulation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.