Recombinant Mouse Neuromedin-U receptor 2 (Nmur2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method or location. For specific delivery times, please consult your local distributors.
Note: Our proteins are shipped standard with blue ice packs. If dry ice shipping is required, please contact us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Nmur2; Neuromedin-U receptor 2; NMU-R2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-395
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MGKLENASWIHDSLMKYLNSTEEYLAYLCGPKRSDLSLPVSVVYALIFVVGVIGNLLVCL VIARHQTLKTPTNYYLFSLAVSDLLVLLLGMPLEVYELWHNYPFLFGPVGCYFKTALFET VCFASILSVTTVSIERYVAIVHPFRAKLESTRRRALRILSLVWSFSVVFSLPNTSIHGIK FQQFPNGSSVPGSATCTVTKPIWVYNFIIQATSFLFYILPMTLISVLYYLMGLRLKRDES LEADKVTVNIHRPSRKSVTKMLFVLVLVFAICWTPFHVDRLFFSFVDEWTESLAAVFNLI HVVSGVFFYLSSAVNPIIYNLLSRRFRAAFRNVVSPSCKWCHPQHRPQGPPAQKVIFLTE CHLVELTEDAGPQFPCQSSIHNTQLTTVPCVEEVP
Uniprot No.

Target Background

Function
Receptor for the neuromedin-U and neuromedin-S neuropeptides.
Gene References Into Functions

NMUR2 Research Highlights:

  1. Research indicates that NMUR2 does not significantly contribute to hypersensitivity following nerve injury or tissue inflammation. PMID: 23349076
  2. Studies demonstrate that deficiencies in neuromedin receptors NMUR1 and NMUR2 do not affect arthritis severity. PMID: 22314006
  3. The circadian rhythm of neuromedin U expression in the suprachiasmatic nucleus does not drive a circadian rhythm of corticotrophin-releasing factor in the paraventricular nucleus. PMID: 15733101
  4. Research investigates the molecular basis of NMU2R regulation of food intake and body weight in mice. PMID: 16781063
  5. NMUR2 plays a more significant role in central pain processing compared to other brain functions, including stress/anxiety and regulation of feeding. PMID: 17030627
  6. The pro-nociceptive effects of neuromedin U in mice appear to be mediated through NMUR2, not NMUR1. PMID: 17379411
  7. Long-term central NMU treatment reduces body weight, food intake, and adiposity. Central NMUR2 signaling is necessary for these effects in female, but not male, mice. PMID: 19584200
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed primarily in brain tissues, more specifically in medulla and spinal cord. Widespread distribution in peripheral tissues.

Q&A

What is the structure and function of mouse Neuromedin-U receptor 2 (Nmur2)?

Nmur2 is a G protein-coupled receptor (GPCR) predominantly expressed in the central nervous system that mediates the effects of neuromedin peptides. The receptor consists of 415 amino acids and primarily couples to Gq/11 proteins, though it also shows coupling to Gi proteins under certain conditions . Structurally, Nmur2 exhibits the characteristic seven-transmembrane domain architecture of Class A GPCRs.

Recent structural studies using cryo-electron microscopy (cryo-EM) have revealed detailed insights into Nmur2's three-dimensional structure. Homology modeling approaches have shown that more than 90% of Nmur2's amino acid residues fall within allowed regions of the Ramachandran plot, indicating a stable protein structure . Functionally, Nmur2 mediates numerous CNS effects including regulation of feeding behavior, energy metabolism, pain response, and stress-related behaviors .

How does Nmur2 tissue distribution differ from Nmur1?

Nmur2 exhibits a distinct expression pattern from Nmur1, which directly relates to their differential physiological roles:

ReceptorPrimary DistributionSecondary SitesFunctional Implications
Nmur2Central nervous system (particularly hypothalamus)Pituitary gland, limited peripheral expressionMediates central effects on feeding, pain, and stress responses
Nmur1Peripheral tissues (GI tract, immune cells)Limited CNS expressionMediates peripheral effects on smooth muscle contraction and immune function

This distribution pattern explains why centrally administered NMU or NMS peptides act primarily through Nmur2 to affect feeding behavior and energy expenditure . The differential expression also provides researchers with an anatomical basis for distinguishing between Nmur1 and Nmur2-mediated physiological effects.

What signaling pathways are activated by Nmur2?

Nmur2 activation triggers multiple intracellular signaling cascades:

When activated, Nmur2 primarily couples to Gq/11 proteins, leading to increased intracellular calcium (Ca²⁺) concentrations through the phospholipase C pathway. Additionally, Nmur2 stimulation activates the extracellular signal-regulated kinase (ERK) pathway . In certain contexts, NMU controls type 2 innate lymphoid cells downstream of ERK and calcium-influx-dependent activation of Calcineurin and nuclear factor of activated T cells (NFAT) .

Small-molecule Nmur2 agonists have been shown to decrease cAMP while stimulating calcium signaling in cells expressing Nmur2, suggesting additional coupling to inhibitory G proteins . Studies examining receptor resensitization have revealed that the rate of resensitization for Nmur2 is shorter after exposure to NMU compared to NMS, and while acute activation of ERK by both ligands is similar, it persists longer after NMS stimulation .

What endogenous ligands bind to mouse Nmur2 and with what relative affinities?

Mouse Nmur2 has two primary endogenous ligands:

  • Neuromedin U (NMU): A 25-amino acid peptide in humans (NmU-25) that was first discovered in porcine spinal cord. It exhibits high affinity for Nmur2, operating at nanomolar concentrations .

  • Neuromedin S (NMS): A 33-amino acid peptide in humans (NmS-33) that shares an identical C-terminal heptapeptide with NMU. Comparative binding studies have demonstrated that "for NMUR2, the binding of NMS is significantly higher than that of NMU" .

Both peptides exert similar biological effects through Nmur2, though with some temporal differences. After receptor activation, the resensitization of Nmur2 occurs more rapidly following NMU exposure compared to NMS. Additionally, while both peptides induce acute ERK activation with similar potency, the activation persists longer following NMS stimulation .

The neuromedin system also includes related peptides called neuromedin U precursor related peptide (NURP) and neuromedin S precursor related peptide (NSRP), though these appear to act through different, as yet unidentified receptors .

What methodological approaches are recommended for generating and validating Nmur2 knockout mouse models?

Based on published approaches, the following methodology has proven effective for generating and validating Nmur2 knockout models:

Generation approach:

  • Retroviral mutagenesis involving infection of 129Sv embryonic stem (ES) cells with a retroviral vector

  • Identification of mutations in the Nmur2 gene by PCR analysis of genomic DNA using vector-specific and gene-specific primers

  • Isolation of mutant clones for animal production using standard methods

  • Breeding of chimeric mice with 129S1/SvImJ mice to generate heterozygotes

  • Genotyping by PCR of tail DNA to identify pups containing a disruption in the Nmur2 gene

  • Verification using Southern blotting to confirm viral insertions and selective breeding to eliminate secondary insertions

Validation approaches:

  • Comprehensive behavioral phenotyping using established tests: 24-h home cage activity with body weight and food intake measurements, open field activity, hot plate test, light-dark box, tail suspension, prepulse inhibition, and contextual fear conditioning

  • Additional specialized tests including elevated plus maze, formalin test, feeding studies, and intracerebroventricular (i.c.v.) injections of NMU peptide

  • Statistical power consideration: using 15-18 WT and 15-18 KO mice per batch to ensure sufficient statistical power against variation in behavioral data

  • Molecular validation including mRNA and protein expression analysis to confirm complete loss of functional Nmur2

How do the binding mechanisms differ between NMU and NMS at the Nmur2 receptor based on structural studies?

Recent structural studies using cryo-electron microscopy have elucidated the binding mechanisms of NMU and NMS to Nmur2:

The structural basis for the higher binding affinity of NMS to Nmur2 (compared to NMU) likely involves specific interactions between the unique N-terminal regions of NMS and the extracellular domains of Nmur2. Since both ligands share an identical C-terminal heptapeptide, the differential binding affinity must arise from these distinct N-terminal regions.

The structures have also revealed that activation of Nmur2 involves a 25-degree rotation of the Gi protein compared to other class A GPCR-Gi complexes, suggesting heterogeneity in the processes of GPCR activation and G protein coupling . This structural insight has significant implications for understanding the receptor's activation mechanism and designing selective ligands.

What explains the seemingly contradictory phenotypes observed in different Nmur2 knockout mouse studies?

The literature reveals interesting discrepancies in Nmur2 knockout mouse phenotypes that require careful consideration:

One study reported that Nmur2 knockout mice maintained on either regular chow or high-fat diets gained significantly less weight than wild-type littermates, showing a modest resistance to diet-induced obesity . This contrasts with other studies finding no body weight differences in Nmur2−/− mice maintained on regular chow in similarly aged mice.

Several factors may explain these discrepancies:

The complexity of these findings underscores the importance of standardized methodologies and comprehensive metabolic phenotyping in Nmur2 research.

How can researchers distinguish between Nmur1 and Nmur2-mediated effects in experimental systems?

Distinguishing between Nmur1 and Nmur2-mediated effects requires careful experimental design:

Anatomical targeting approaches:

  • Central administration (intracerebroventricular injection) of NMU or NMS primarily targets Nmur2 due to its predominant CNS expression

  • Peripheral administration may affect both receptors but with greater impact on Nmur1-expressing tissues

Genetic approaches:

  • Use of receptor-specific knockout models: Behavioral effects induced by intracerebroventricular NMU administration were abolished in NMUR2 knockout mice, establishing a causal role for NMUR2

  • Tissue-specific conditional knockout models can provide further specificity

Pharmacological approaches:

  • Application of small-molecule NMUR2 agonists (such as NY0116 and NY0128) that selectively activate Nmur2

  • Development of "highly specific NMUR1 and NMUR2 receptor antagonists would allow for a more detailed understanding of the mechanisms of action"

Molecular approaches:

  • In vitro studies with cells transfected with either Nmur1 or Nmur2 can isolate receptor-specific signaling responses

  • Analysis of differential temporal patterns in downstream signaling (e.g., the different resensitization rates and ERK activation patterns following NMU vs. NMS stimulation)

The combination of these approaches provides the most robust evidence for receptor-specific effects.

What are the latest approaches for developing selective small-molecule agonists targeting mouse Nmur2?

Recent advances in developing selective Nmur2 agonists have employed both rational structure-based design and functional screening:

Two small-molecule NMUR2 agonists, NY0116 and NY0128, have demonstrated promising results in both in vitro and in vivo studies. The development pipeline for these compounds involved:

  • Structure-based design: Utilizing structural insights from cryo-EM studies of Nmur2 to identify key binding pocket characteristics

  • In vitro functional screening: Testing in stably expressing NMUR2 HEK293 cells to verify that candidates "decreased cAMP while stimulating calcium signaling"

  • Efficacy validation: In vivo testing where "acute administration significantly decreased high-fat diet consumption" and "repeated administration decreased body weight and visceral adipose tissue in obese mice"

The most effective compounds appear to have distinctive pharmacological profiles where they decrease cAMP (suggesting Gi coupling) while simultaneously stimulating calcium signaling (suggesting Gq coupling) . This dual signaling profile may be important for recapitulating the full physiological effects of endogenous neuromedin peptides.

Recent structural studies have further refined our understanding of "the key factors that govern the recognition and selectivity of peptide agonist as well as non-peptide antagonist, providing the structural basis for design of novel and highly selective drugs targeting NMU2" .

What techniques are most effective for studying Nmur2 activation in primary neurons?

Based on the signaling mechanisms of Nmur2, several complementary techniques can be employed to study its activation in primary neurons:

Calcium imaging techniques:

  • Real-time calcium imaging using fluorescent calcium indicators (Fluo-4, Fura-2) to detect the robust calcium response that follows Nmur2 activation

  • These approaches can be coupled with pharmacological inhibitors of specific pathways to dissect the signaling cascade

Phosphorylation assays:

  • Western blotting or immunocytochemistry for phosphorylated ERK (pERK), as Nmur2 activation triggers the ERK pathway

  • Monitoring of calcium/calmodulin-dependent protein kinase II (CaMKII) activation, a downstream effector in calcium signaling pathways

Electrophysiological approaches:

  • Patch-clamp recordings to measure changes in neuronal excitability and synaptic transmission following Nmur2 activation

  • These can be coupled with pharmacological manipulations to identify the specific ion channels modulated by Nmur2 signaling

Nuclear translocation assays:

  • Tracking nuclear translocation of NFAT following Nmur2 activation, as NMU controls downstream effects via "calcium-influx-dependent activation of Calcineurin and nuclear factor of activated T cells (NFAT)"

Receptor trafficking studies:

  • Live-cell imaging of fluorescently tagged Nmur2 to monitor internalization and trafficking following activation

  • This is particularly relevant given the differential resensitization rates observed with NMU versus NMS

For all these techniques, appropriate controls using Nmur2 knockout neurons or selective antagonists are essential to confirm specificity of the observed responses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.