Recombinant Mouse Neuronal acetylcholine receptor subunit beta-4 (Chrnb4)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant Chrnb4 is expressed in multiple systems, with variations in yield and post-translational modifications:

Expression SystemPurityApplicationsSource
E. coli≥85%–90%Structural studies, antibody generation
Mammalian cells≥85%Functional assays, ion channel reconstitution
Cell-free expression≥85%High-throughput screening

Lyophilized formulations in Tris/PBS buffers ensure stability, though repeated freeze-thaw cycles are discouraged .

Retinal Development and Transplantation

The Chrnb4-EGFP mouse model revealed:

  • Cone photoreceptor specificity: CHRNB4 is expressed in retinal cones from embryogenesis (E12) through adulthood, co-localizing with RXRγ .

  • Transplantation potential: E15.5 Chrnb4-EGFP⁺ cells integrated into host retinas, with 80% showing bidirectional material exchange with DsRed⁺ host cones .

  • Therapeutic implications: Demonstrated fusion-mediated repair in retinal dystrophy models .

Neurological and Disease Associations

  • Nicotine dependence: CHRNB4 variants correlate with altered receptor sensitivity in addiction pathways .

  • Cancer biomarkers: Overexpression in head/neck cancer and breast cancer lines suggests diagnostic potential .

  • Neurodegeneration: Linked to frontotemporal dementia pathology via cholinergic signaling deficits .

Functional Assays and Validation

MethodOutcomeReference
Western blot (WB)Detected in SH-SY5Y cells, mouse testis
Flow cytometry (FC)Confirmed surface expression in live cells
Immunohistochemistry (IHC)Localized to cone photoreceptor membranes

Antibodies like clone N434/60 and 22192-1-AP show high specificity for CHRNB4 in human and mouse tissues .

Challenges and Future Directions

  • Heterologous expression limitations: Lack of native post-translational modifications in E. coli-derived protein .

  • Therapeutic targeting: Material exchange in transplanted cells raises questions about fusion mechanisms .

  • Disease modeling: CHRNB4 knockout mice could clarify its role in addiction and neurodegeneration .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have any specific format requirements, please specify them in your order. We will prepare the product based on your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for the specific delivery timeline.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize the development of the specified tag.
Synonyms
Chrnb4; Acrb4; Neuronal acetylcholine receptor subunit beta-4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-495
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Chrnb4
Target Protein Sequence
RLANAEEKLMDDLLNKTRYNNLIRPATSSSQLISIRLELSLSQLISVNEREQIMTTSIWL KQEWTDYRLAWNSSCYEGVNILRIPAKRVWLPDIVLYNNADGTYEVSVYTNVIVRSNGSI QWLPPAIYKSACKIEVKHFPFDQQNCTLKFRSWTYDHTEIDMVLKSPTAIMDDFTPSGEW DIVALPGRRTVNPQDPSYVDVTYDFIIKRKPLFYTINLIIPCVLITSLAILVFYLPSDCG EKMTLCISVLLALTFFLLLISKIVPPTSLDIPLIGKYLLFTMVLVTFSIVTTVCVLNVHH RSPSTHTMASWVKECFLHKLPTFLFMKRPGLEVSPARVPHSSQLHLTTAEATSTSALGPS SPSNLYGNSMYFVNPVPATPKSAVSSHTAGLPRDARLRSSGRFRQDLQEALEGVSFIAQH LESDDRDQSVIEDWKFVAMVVDRLFLWVFVIVCILGTMGLFLPPLFQIHAPSKGL
Uniprot No.

Target Background

Function
Upon binding acetylcholine, the AChR undergoes a significant conformational change that affects all subunits. This change leads to the opening of an ion-conducting channel across the plasma membrane.
Gene References Into Functions
  1. Research suggests that beta4* nAChRs in the interpeduncular nucleus play a role in maintaining nicotine intravenous self-administration. PMID: 26585290
  2. Data indicates that the nicotinic acetylcholine receptor beta4 subunit (beta4 subunit) is not involved in ethanol responses. PMID: 28381286
  3. MAFA regulates autonomic nervous system-mediated insulin secretion by activating the transcription of nicotinic (ChrnB2 and ChrnB4) receptor genes, which is impaired in type 2 diabetes. PMID: 26904947
  4. The alpha3beta4* nicotinic ACh receptor subtype mediates physical dependence to morphine PMID: 24750073
  5. nAChRs containing the beta4 subunit are crucial for social behaviors. PMID: 23042983
  6. Downregulation of nAChR subunit and PSD-93 expression after cavernous nerve injury, or even manipulation, could disrupt synaptic transmission within the MPG, contributing to the loss of neural control of urogenital organs following pelvic surgeries. PMID: 24049141
  7. Findings suggest a significant role for the a3b4* nAChR subtype in nicotine reward and the physical aspects of the nicotine withdrawal syndrome. PMID: 23416040
  8. Chrnb4 is involved in anxiety- and potentially depression-like behaviors and contributes to the analgesic effects of nicotine. PMID: 22573727
  9. Mutation reduced fusion rates of alpha4beta4 receptor-containing vesicles with the plasma membrane by approximately 2-fold, with only a slight decrease in the number of nAChRs per vesicle. The mutation also decreased the number of endoplasmic reticulum exit sites PMID: 21768117
  10. At higher doses, varenicline acts as an agonist of Chrnb4, producing physiological changes in mice. PMID: 22241831
  11. These findings indicate a significant role for Chrna7 and Chrnb4 -containing nicotinic acetylcholine receptors in the anhedonic or somatic signs of nicotine withdrawal PMID: 22009521
  12. A mechanistic model proposes sharpening of mitral cell receptive fields by activation of the alpha3beta4 subtype of nicotinic receptor, which could aid in odor discrimination and perceptual learning. PMID: 22378897
  13. This study demonstrated that alpha3beta4alpha5 receptor-mediated mechanisms contribute to nicotine consumption, and identifies the medial habenula as a critical element in the circuitry controlling nicotine-dependent phenotypes. PMID: 21555077
  14. The CA box is critical for beta4 promoter activity in vivo. PMID: 20696214
  15. Polymorphisms located within the Chrna5-Chrna3-Chrnb4 cluster on mouse chromosome 9 were found to co-segregate with alcohol preference, with high-drinking F(2) mice carrying B6 alleles and low-drinking F(2) mice carrying D2 alleles. PMID: 20496163
  16. Beta 4 subunits are essential components of nAChRs in autonomic ganglia. Deficiency of beta 4 subunits altered ion channel properties, conductance, and sensitivity and affinity of receptors to agonists and antagonists, affecting ganglionic transmission. PMID: 12606764
  17. Tests on beta4-knockout mice revealed that beta4-containing nAChRs influence behavioral responses during anxiety-related tests, and that this effect depends on the type of anxiety-provoking experience PMID: 12867510
  18. Immunohistochemical analysis of nAChRbeta4 in the mouse brain suggests a widespread and potentially diverse role for this subunit in both excitatory and inhibitory neurotransmission. PMID: 14681928
  19. There is a significant role for beta4-containing nicotinic acetylcholine receptors in the appearance of nicotine withdrawal symptoms. PMID: 15537871
  20. The involvement of the beta4 nAChR subunit in both core body temperature homeostasis and nicotine-elicited thermo-alterations in mice. PMID: 15925141

Show More

Hide All

Database Links
Protein Families
Ligand-gated ion channel (TC 1.A.9) family, Acetylcholine receptor (TC 1.A.9.1) subfamily, Beta-4/CHRNB4 sub-subfamily
Subcellular Location
Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Predominantly expressed by immature T-cells in the thymus.

Q&A

What is Chrnb4 and where is it expressed in the nervous system?

Chrnb4 is a subunit of the nicotinic acetylcholine receptor (nAChR) that forms pentameric ion channels involved in fast synaptic transmission. Expression studies have revealed that Chrnb4 transcripts are found in restricted brain regions but are abundantly expressed in peripheral neurons. Unlike the widely distributed β2 subunit, β4 shows a more limited expression pattern in the central nervous system (CNS) .

The β4 subunit is particularly prominent in autonomic ganglia, including the superior cervical ganglion, where it forms functional nAChRs that play critical roles in autonomic nervous system signaling. The concurrent expression of β2 and β4 in the peripheral nervous system (PNS) suggests these subunits might be functionally related in the formation of autonomic nAChRs in mammals .

How does Chrnb4 contribute to functional nAChR diversity?

Chrnb4 typically assembles with the α3 subunit to form α3β4-containing receptors, which represent one of the major subtypes of nAChRs in autonomic ganglia. Research using knockout mouse models has demonstrated that α3 and β4 are requisite participants in the majority of functional ganglionic nAChRs .

The subunit composition influences several functional properties including:

Propertyα3β4 Receptorsα3β2 Receptors
Desensitization rateSlowerFaster
Channel open timeLongerShorter
Pharmacological profileHigher sensitivity to cytisineHigher sensitivity to ABT-418
Calcium permeabilityModerateModerate

The β4 subunit can also co-assemble with other α subunits (including α5) to form receptors with distinct pharmacological and biophysical properties. Electrophysiological studies have shown that acetylcholine-activated whole-cell currents are significantly reduced in neurons from β4−/− mice and completely absent in neurons from β2−/−β4−/− double knockout mice .

What mouse models are available for Chrnb4 research?

Several mouse models have been developed to study Chrnb4 function:

  • β4 Knockout (β4−/−) Mice: These mice lack functional expression of the β4 subunit but develop normally without visible phenotypic abnormalities, suggesting potential compensatory mechanisms .

  • Double Knockout (β2−/−β4−/−) Mice: Generated by breeding mice with single-gene mutations, these animals exhibit severe autonomic dysfunction, growth retardation, and increased perinatal mortality .

  • Chrnb4.EGFP Transgenic Mice: These mice express enhanced green fluorescent protein (EGFP) under the control of the Chrnb4 promoter, providing a valuable tool for visualizing cells that express this receptor subunit .

For validating gene deletion, researchers have employed methods such as Northern blot analysis using rat β2 cDNA probes and reverse transcription-PCR (RT-PCR) with specific primers like 5′-GCATCTGGAGAGCGATGACCGAGATCAAAG-3′ (β4 RT-1 forward) and 5′-TAGCCTAGGAGTCCTTGGAGGGTGCGTGGA-3′ (β4 RT-2 reverse) .

How can Chrnb4.EGFP fluorescent models be applied in research?

The Chrnb4.EGFP mouse model represents a powerful tool for studying specific cell populations that express the β4 subunit. Recent research has validated this model for studying cone photoreceptor biology since these retinal cells express the Chrnb4 promoter .

Validation approaches include:

  • Immunohistochemistry: Comparing GFP+ cells with known markers of target cell populations

  • Quantitative real-time PCR: Analyzing gene expression differences between Chrnb4.EGFP and wild-type tissues

  • Functional assays: Using electroretinograms to assess physiological differences

This model allows for direct visualization and isolation of specific cell populations for:

  • Cell-specific transcriptomic analysis

  • Live-cell imaging studies

  • Targeted electrophysiological recordings

  • Flow cytometry-based cell sorting

What electrophysiological approaches are most effective for studying Chrnb4-containing receptors?

Whole-cell patch-clamp recording has proven particularly valuable for studying Chrnb4-containing receptors. In superior cervical ganglion neurons from knockout mice, researchers have demonstrated that acetylcholine-activated whole-cell currents are absent in β2−/−β4−/− mice and significantly reduced in β4−/− mice .

For functional characterization of tissue-specific effects, techniques such as electric field stimulation of bladder strips have been employed to assess frequency-response relationships. Such studies have revealed that frequency-response curves for β2−/−β4+/+ mice are similar to wild-type mice, whereas those for β2+/+β4−/− and β2−/−β4−/− mice show a leftward shift, indicating altered sensitivity .

What phenotypic abnormalities occur in Chrnb4 knockout models?

The phenotypic consequences of Chrnb4 deletion depend on whether it is knocked out alone or in combination with other nAChR subunits:

ModelViabilityPhysical PhenotypeAutonomic FunctionNeurophysiology
β4−/−Normal survivalNo visible abnormalitiesSubtle bladder dysfunctionReduced ACh-elicited currents in SCG neurons
β2−/−β4−/−Increased perinatal mortalityGrowth retardation, ptosisSevere megacystis, hypoperistalsis, mydriasisAbsent ACh-elicited currents in SCG neurons

The β2−/−β4−/− double knockout phenotype includes enlarged bladders with dribbling urination, urinary infection, bladder stones, and widely dilated pupils that do not constrict in response to light. Histological studies reveal hyperplasia in the bladder mucosa of both β4−/− and β2−/−β4−/− mutants .

The severity of the double knockout phenotype compared to the relatively normal appearance of single knockouts suggests functional redundancy between β2 and β4 subunits in autonomic ganglia during development and adulthood.

How does Chrnb4 influence nicotine dependence and related behaviors?

The CHRNA5-CHRNA3-CHRNB4 gene cluster on chromosome 15q24-25 has been implicated in nicotine dependence. Research using samples from the Finnish Twin Cohort study has revealed significant associations between variants in this cluster and multiple smoking-related phenotypes .

Key findings include:

  • DSM-IV nicotine dependence symptoms associate significantly with proxy SNP Locus 1 (rs2036527, p = .000009) and Locus 2 (rs578776, p = .0001) .

  • The tolerance factor of the Nicotine Dependence Syndrome Scale (NDSS) shows suggestive association with several SNPs in CHRNB4, including rs11636753 (p = .0059), rs11634351 (p = .0069), and rs1948 (p = .0071) .

  • SNPs in the cluster exhibit pleiotropic effects, associating not only with nicotine dependence measures but also with regular drinking (rs11636753, p = .0029) and the comorbidity of depression and nicotine dependence (rs11636753, p = .0034) .

These findings suggest that Chrnb4 plays a significant role in addiction-related behaviors beyond its function in autonomic ganglia.

How can researchers effectively utilize Chrnb4 models for studying comorbid conditions?

The pleiotropic effects of the CHRNA5-CHRNA3-CHRNB4 gene cluster on multiple phenotypes make these models valuable for studying comorbidities. Research has identified associations between this cluster and the comorbidity of nicotine dependence with depression , suggesting these models can be used to investigate shared neurobiological mechanisms.

Methodological considerations include:

  • Cross-phenotype analysis: Assess multiple behavioral domains (addiction, affect, cognition) in the same animals to identify correlations.

  • Tissue-specific manipulations: Use conditional knockout or viral-mediated gene transfer to target specific neural circuits implicated in comorbid conditions.

  • Integrative multi-omics: Combine transcriptomic, proteomic, and metabolomic analyses to identify molecular signatures associated with comorbid phenotypes.

  • Longitudinal designs: Track the development of different phenotypes over time to understand the temporal relationship between conditions.

What are the current approaches for studying Chrnb4 in tissue-specific contexts?

Several approaches have been developed to study Chrnb4 function in specific tissues:

  • Fluorescent reporter models: The Chrnb4.EGFP mouse model allows visualization of cells expressing Chrnb4, facilitating their isolation and characterization. This approach has been validated for studying cone photoreceptors .

  • Tissue-specific functional assays: For example, bladder strips from β4 mutants have been studied using nicotinic agonists and electric field stimulation to assess autonomic function .

  • Single-cell transcriptomics: This approach can identify cell populations with high Chrnb4 expression and characterize their molecular signatures.

  • Optogenetic manipulations: By expressing light-sensitive opsins in Chrnb4-expressing neurons, researchers can precisely control their activity to assess their contribution to circuit function.

What controls are essential when using Chrnb4 knockout models?

When working with Chrnb4 knockout models, several controls are critical for experimental validity:

  • Genetic background matching: Ensure that experimental and control groups are on the same genetic background to avoid confounding effects.

  • Littermate controls: Use littermates as controls whenever possible to minimize environmental variability.

  • Functional validation: Confirm the absence of β4-containing receptors through electrophysiological recordings, as demonstrated in superior cervical ganglion neurons .

  • Alternative pathway assessment: Test for compensatory upregulation of other nAChR subunits or alternative signaling pathways, particularly in single knockout models that show limited phenotypes despite the confirmed absence of the target protein.

  • Developmental considerations: Since Chrnb4 plays a role in development, consider using conditional knockouts for studying adult-specific functions to avoid developmental confounds.

How can researchers address potential developmental compensation in Chrnb4 models?

The relatively normal phenotype of β4−/− single knockout mice despite significant reductions in nicotinic currents suggests compensatory mechanisms . Researchers can address this issue through:

  • Acute manipulations: Use pharmacological tools or viral-mediated knockdown to achieve acute rather than developmental Chrnb4 manipulation.

  • Conditional knockout strategies: Employ inducible Cre-loxP systems to delete Chrnb4 at specific developmental timepoints.

  • Comprehensive subunit profiling: Quantify expression levels of all nAChR subunits in tissues of interest to identify potential compensatory upregulation.

  • Functional redundancy testing: Create compound mutants (as demonstrated by the β2−/−β4−/− model) to unmask phenotypes hidden by redundant systems .

  • Stress challenges: Subject animals to physiological or pharmacological stressors that may reveal phenotypes not apparent under baseline conditions.

How might Chrnb4.EGFP models be extended to other research applications?

The Chrnb4.EGFP mouse model has been validated for studying cone photoreceptors , but its potential extends to other research applications:

  • Neural circuit mapping: Using the fluorescent tag to identify and trace connections between Chrnb4-expressing neurons and their targets.

  • Drug screening: Employing the model for high-throughput screening of compounds that modulate Chrnb4-containing receptors.

  • Disease modeling: Crossing Chrnb4.EGFP mice with disease models to visualize changes in Chrnb4-expressing cells during pathological processes.

  • Live imaging studies: Utilizing the fluorescent tag for real-time monitoring of Chrnb4-expressing cells in vivo using techniques like two-photon microscopy.

What emerging technologies could advance Chrnb4 research?

Several cutting-edge technologies hold promise for advancing Chrnb4 research:

  • CRISPR-Cas9 gene editing: For creating precise modifications to the Chrnb4 gene or its regulatory elements.

  • Spatial transcriptomics: To map the expression of Chrnb4 and related genes across tissue sections with high spatial resolution.

  • Cryo-electron microscopy: For determining the atomic structure of Chrnb4-containing receptors in different conformational states.

  • Chemogenetics: Using designer receptors exclusively activated by designer drugs (DREADDs) to selectively modulate Chrnb4-expressing cell activity.

  • Single-molecule imaging: To track the dynamics of individual Chrnb4-containing receptors in living cells.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.