Recombinant Mouse Neuropeptide Y receptor type 2 (Npy2r)

Shipped with Ice Packs
In Stock

Description

Biological Roles and Relevance

The Y2 receptor mediates diverse physiological and pathological processes:

  • Neurotransmitter Regulation: Presynaptic Y2 receptors inhibit glutamate, GABA, and noradrenaline release, modulating synaptic plasticity .

  • Feeding Behavior: Npy2r knockout mice exhibit increased food intake and body weight, suggesting a role in satiety signaling .

  • Kidney Disease: Podocyte-specific NPY2R signaling exacerbates albuminuria in diabetic and nondiabetic nephropathy models. Pharmacological inhibition of NPY2R reduces glomerular damage .

  • Memory and Anxiety: Npy2r deficiency in mice alters spatial memory and anxiety-related behaviors, highlighting its role in neurobehavioral modulation .

Production and Quality Assurance

Recombinant Npy2r is synthesized via:

  1. Cloning: The Npy2r gene is inserted into plasmid vectors for expression in host systems.

  2. Purification: Tags enable affinity chromatography (e.g., nickel columns for His-tags) .

  3. Validation: SDS-PAGE, Western blotting, and functional assays confirm identity and activity .

Host SystemAdvantagesApplications
E. coliHigh yield, low costStructural studies, ligand-binding assays
Mammalian CellsProper post-translational modificationsFunctional assays, signaling pathway studies
Cell-Free SystemsRapid production, flexible conditionsHigh-throughput screening

Research Applications

Recombinant Npy2r is critical for:

  • Ligand Interaction Studies: Identifying agonists/antagonists (e.g., PYY(3–36), BIIE0246) .

  • Signaling Pathway Analysis: Investigating PI3K, MAPK, and NFAT activation in kidney podocytes .

  • Therapeutic Development: Testing NPY2R inhibitors (e.g., BIIE0246) in kidney disease models .

Key Findings:

  1. Kidney Disease: NPY2R antagonists reduce albuminuria and podocyte injury in adriamycin-induced glomerulosclerosis .

  2. Metabolic Regulation: Npy2r deficiency in medaka fish increases food intake and growth rate, mirroring mammalian studies .

  3. Neurological Insights: Npy2r knockout mice show impaired episodic fear memory but improved spatial working memory .

Challenges and Future Directions

  • Low Expression: Full-length Npy2r is challenging to produce due to hydrophobicity and instability .

  • Functional Assays: Partial recombinant proteins may lack full activity, necessitating mammalian-cell-derived proteins for signaling studies .

  • Therapeutic Potential: Targeting NPY2R in kidney disease requires balancing systemic NPY levels and glomerular signaling .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them during order placement. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please let us know. We will prioritize developing the specified tag.
Synonyms
Npy2r; Neuropeptide Y receptor type 2; NPY2-R; NPY-Y2 receptor; Y2 receptor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-385
Protein Length
Full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MVLKMGPVGAEADENQTVEVKVEPYGPGHTTPRGELPPDPEPELIDSTKLVEVQVILILA YCSIILLGVVGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEW KMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKRISFLIIGLAWGIS ALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSVYGTVYSLSTLLILYVLPLGIIS FSYTRIWSKLRNHVSPGAASDHYHQRRHKMTKMLVCVVVVFAVSWLPLHAFQLAVDIDSH VLDLKEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAFRCEQRLDAIHSEVSMT FKAKKNLEVKKNNGPTDSFSEATNV
Uniprot No.

Target Background

Function
Receptor for neuropeptide Y and peptide YY.
Gene References Into Functions
  1. High Npy2r expression is associated with chronic social defeat stress. PMID: 30201296
  2. These results indicate that endogenous PYY has a hypoalgesic effect on somatic thermal and visceral chemical pain. The effect on visceral pain seems to be mediated by peripheral Y2 receptors. PMID: 28106168
  3. NPY and agonists of Y2R and Y5R may be neuroprotective against oxygen-glucose deprivation-induced neuronal cell death in primary cortical cell cultures after delayed treatment. A Y2R agonist not only diminished transient cerebral ischemia-induced neuronal injury, but also improved functional outcome after delayed treatment. Y5 and especially Y2 receptors may be promising targets for neuroprotection against ischemic damage PMID: 28057538
  4. Findings suggest that neuropeptide Y is expressed by distinct populations of neurons can modulate afferent and efferent projections of the central amygdala via presynaptic Y2 receptors located at inhibitory and excitatory synapses. PMID: 26365505
  5. confirms the critical role of Y2 signalling to control neuropeptide Y and associated pro-opiomelanocortin expression in the arcuate nuclei PMID: 26444586
  6. Study shows that NPY inhibits fear learning and promotes cued extinction by reducing fear expression also via activation of presynaptic Y2 receptors on central amygdala neurons PMID: 26314208
  7. Our results showed the altered expression of NPY, Y1R and Y2R but not Y5R in hippocampus and temporal lobe cortex of tremor rat brain. PMID: 24444822
  8. Data from knockout (KO) mice suggest roles for neuropeptide Y (NPY) and NPY2 receptors in fear acquisition/fear stimulus discrimination. Npy1r/Npy2r double KO mice display excessive recall of conditioned fear/impaired fear extinction. PMID: 22289084
  9. NPY Y2 receptors control the level of hyperactive behavior under conditions of limited food access. PMID: 21923762
  10. Peripheral Y2 receptor signaling is critical in the regulation of oxidative fuel selection and physical activity and protects against high-fat diet-induced obesity. PMID: 21546930
  11. NPY-Y2 receptor exerts a direct control over both the tonic and phasic release of dopamine PMID: 21055451
  12. Data describe the complex interaction between Y2/Y4 receptors in control of bone mass, and suggest that the reduction in cortical bone observed in the absence of leptin is due to the anti-osteogenic effect of elevated hypothalamic NPY levels. PMID: 20635164
  13. Data from studies in knockout mice suggest that signaling through Y2 receptor prevents development of long-term anxiety-/depression-like behaviour caused by acute immune challenge. Study includes comparison with Y4 receptor knockout mice. PMID: 19939871
  14. Taken together, this work demonstrates the critical roles of Y2 and Y4 receptors in the regulation of body composition and energy metabolism, highlighting dual antagonism of Y2 and Y4 receptors as a potentially effective anti-obesity treatment. PMID: 20881101
  15. PYY/PYY(3-36) potently inhibits basal and stress/serotonin/cholinergic-stimulated propulsive colonic motor function in conscious mice, likely via Y(2) receptors PMID: 19892938
  16. data reveal an anti-osteogenic effect of Y2 receptors on hypothalamic NPY-expressing neurons on trabecular but not on cortical bone PMID: 20613867
  17. In Y2 knockout mice motor activity in the antrum was more affected than that in the duodenum, and both fed and fasted motor activities were affected in the antrum. PMID: 20501433
  18. Results indicate that NPY Y2 receptor agonists inhibit diarrhea in mice by not only reducing intestinal fluid secretion, but also slowing colonic transit. PMID: 19925840
  19. results are evidence of the highly site-specific nature of the Y2-mediated function of NPY in the modulation of anxiety- and depression-related behavior. PMID: 20445054
  20. Y2 depletion influences a range of behaviours, which are potentially relevant for schizophrenia-related research PMID: 19879900
  21. These findings attest to a differential role of Y2 and Y4 receptor signalling in the circadian control of behaviours that balance energy intake and energy expenditure. PMID: 19781771
  22. Role of neuropeptide Y Y(2) receptors in modulation of cardiac parasympathetic neurotransmission PMID: 11786149
  23. hypothalamic Y2 receptors are involved in a tonic inhibition of bone formation. PMID: 11927618
  24. role in body weight regulation PMID: 12072562
  25. Y2 receptor participates in cholesterol and glucose homeostasis of obese mice PMID: 12126735
  26. PYY(3-36) inhibits food intake in mice but not in Y2r-null mice, which suggests that the anorectic effect requires the Y2R PMID: 12167864
  27. Deletion of this receptor results in blockage of NPY-induced angiogenesis and delayed wound healing. PMID: 12730369
  28. NPY Y(2) receptors may play an inhibitory role and supports the hypothesis that Y(2) receptors are involved in the regulation of anxiety-like behaviours by NPY PMID: 12742262
  29. tonic activation of submucosal Y(2) receptors could indirectly reduce mucosal ion transport in the colon, while direct activation of Y(2) receptors on longitudinal muscle results in contraction PMID: 12813010
  30. deletion of the Y2 receptor has revealed an important role of Y2 receptors in the generation of anxiety-related and stress-related behaviours in mice PMID: 12859347
  31. Y2 and Y4 receptors have roles in adiposity and bone mass PMID: 12861009
  32. High levels of NPY-Y2R expression in the preoptic nuclei suggest involvement of Y2R in the regulation of reproductive behavior, whereas Y2R expression in arcuate, dorsomedial, and perifornical nuclei may be relevant to feeding and body weight control. PMID: 14755515
  33. NPY Y2-/- mice displayed a deficit on the probe trial in the Morris water maze task, and exhibited marked deterioration in object memory 6 h, but not 1 h, following initial exposure in the object recognition test PMID: 14997009
  34. Results provide strong evidence for the role of the Y2 receptor mediating neuropeptide Y subjective day phase-advance shifts in mice. PMID: 15619538
  35. Taken together, these data suggest that, in mice, both Y2 and Y5 receptors regulate hippocampal seizures in vitro, while activation of Y5 receptors in extra-hippocampal regions reduces generalized seizures in vivo. PMID: 15979311
  36. These results demonstrate that the NPY Y2R is associated mainly with both peptidergic and nonpeptidergic small, presumably nociceptive, neurons projecting to the superficial layers of the dorsal horn. PMID: 16025447
  37. A role is indicated for NPY-Y2 receptors in the accumulation of adipose tissue in the hypogonadal state; hypothalamic Y2 receptors constitutively restrain osteoblastic activity even in the absence of sex hormones. PMID: 16785231
  38. The Y2-mediated anabolic pathway stimulates cortical and cancellous bone formation. PMID: 16995815
  39. The widespread distribution of Y2R-positive cell bodies and fibers suggests that NPY signaling through the Y2R is common in the mouse brain. PMID: 16998904
  40. Release of NPY tonically inhibits synaptic transmission in mice and its effects are mediated by Y2 receptor activation. However, both NPY and BIIE0246 were much less effective in mice than in rats. PMID: 17027162
  41. fasting inhibits the somatotropic axis via direct action on Y2 receptors in the Arcuate nucleus and indirectly inhibits the gonadotropic axis via Y4 receptors. PMID: 17272395
  42. Diet-induced obese mice had low plasma PYY, which may have caused compensatory up-regulation of PYY and Y2 receptor densities in medulla. PMID: 17615145
  43. activation of neurons in the nucleus of the solitary tract following administration of T2R agonists to the GI tract involves CCK(1) and Y(2) receptors located on vagal afferent terminals in the gut wall PMID: 18003792
  44. Data show that the replacement of a high-fat diet with a low-fat diet was associated with a significant lowering of ventromedial hypothalamic neuropeptide Y Y2 receptor binding, and also a lowered plasma PYY level. PMID: 18357520
  45. Mice lacking Y2 receptors exhibited reduced neuronal activation when compared to WT animals in response to the emotional stressors. PMID: 19084906
  46. critical role for neuropeptide Y/neuropeptide Y2 receptor interactions in adipogenesis PMID: 19182605

Show More

Hide All

Database Links

KEGG: mmu:18167

STRING: 10090.ENSMUSP00000096595

UniGene: Mm.1433

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the primary function of NPY2R in physiological systems?

NPY2R functions primarily as a G protein-coupled receptor that mediates the effects of Neuropeptide Y (NPY), a 36-amino acid peptide neurotransmitter present in both central and peripheral nervous systems. In physiological contexts, NPY2R activation modulates several key signaling cascades including PI3K, MAPK, and NFAT pathways . The receptor is involved in the regulation of homeostatic functions such as eating behavior, anxiety responses, and reproduction . Research has demonstrated that NPY2R plays significant roles in kidney function, with its activation contributing to podocyte injury and albuminuria in various kidney disease models . Notably, the NPY-NPY2R signaling axis also participates in pain modulation via mechanisms in the amygdala, suggesting its importance in neurological functions beyond metabolic regulation .

How does NPY2R expression differ between healthy and disease states?

The expression pattern of NPY2R shows remarkable tissue-specific alterations in disease conditions. In kidney disease, local NPY production by podocytes decreases, contrasting with increased circulating NPY levels in the plasma and urine . This paradoxical expression pattern suggests complex regulatory mechanisms governing NPY-NPY2R signaling in disease states. In neuropathic pain conditions induced by chronic constriction injury (CCI) of the sciatic nerve, both NPY and NPY2R expression are aberrantly upregulated in the amygdala . This upregulation correlates with decreased mechanical withdrawal threshold and thermal withdrawal latency, indicating enhanced pain sensitivity. These differential expression patterns highlight the context-dependent nature of NPY2R regulation and function across different pathophysiological conditions.

What is known about the structural characteristics of mouse NPY2R?

Mouse NPY2R belongs to the G protein-coupled receptor superfamily, characterized by seven transmembrane domains. The C-terminus of mouse NPY2R contains the amino acid sequence CEQRLDAIHSEVSMTFKAK (residues 346-364), which is located intracellularly and serves as a key region for antibody recognition in experimental applications . The conserved seven transmembrane domains are essential for the receptor's functionality, as demonstrated in knockout studies where their loss resulted in complete functional ablation . The receptor shares structural homology with other NPY receptor subtypes (Y1, Y4, Y5), but displays distinct ligand binding properties and downstream signaling preferences that contribute to its unique physiological roles.

What are the most effective models for studying NPY2R function?

Several experimental models have proven valuable for investigating NPY2R function:

Model TypeAdvantagesLimitationsKey Applications
Global NPY2R knockout miceComplete receptor elimination across tissuesPotential developmental compensationSystemic physiological assessment
Conditional tissue-specific knockoutsTargeted deletion in tissues of interestRequires tissue-specific Cre linesDissecting tissue-specific functions
CRISPR/Cas9-modified medakaAlternative vertebrate model for evolutionary insightsSpecies differences in receptor functionComparative physiology studies
Cell culture systems (podocytes, neurons)Controlled manipulation of signalingMay not recapitulate in vivo complexityMechanistic investigations

For kidney-related studies, adriamycin-induced nephropathy models in mice with NPY2R manipulation have proven particularly informative for understanding the receptor's role in albuminuria and podocyte injury . For neurological and behavioral studies, mirror tests and open-field assessments in NPY2R-deficient models provide valuable insights into anxiety and social behaviors . The choice of model should align with the specific research question, acknowledging that species differences may influence receptor function and signaling outcomes.

What techniques are recommended for measuring NPY2R expression and activity?

Multiple complementary techniques can be employed to comprehensively assess NPY2R expression and activity:

For protein detection:

  • Western blot analysis using specific antibodies targeting the C-terminal region (amino acids 346-364) of mouse NPY2R has been successfully employed to detect the receptor in hippocampus and whole brain lysates .

  • Immunohistochemistry and immunocytochemistry can visualize NPY2R localization in tissue sections (e.g., cerebellum) and primary cell cultures (e.g., dorsal root ganglion neurons) .

For gene expression analysis:

  • Quantitative RT-PCR using NPY2R-specific primers allows sensitive detection of mRNA expression levels relative to housekeeping genes such as β-actin .

  • RNA sequencing can provide comprehensive transcriptomic insights into NPY2R expression patterns and associated gene networks.

For functional assessment:

  • High-resolution Tandem Mass Tagged (TMT)-based spectrometry can analyze proteome-wide changes following NPY-NPY2R signaling activation or blockade .

  • Calcium imaging and electrophysiology techniques can measure immediate receptor activation responses.

  • Behavioral assessments such as the mirror test and open-field test can evaluate anxiety and social behaviors in NPY2R-modified animal models .

How can I effectively generate and validate NPY2R knockout models?

Generating robust NPY2R knockout models requires careful design and comprehensive validation:

Generation strategies:

  • CRISPR/Cas9 system has been successfully employed to create NPY2R-deficient models by targeting coding regions essential for receptor function. In medaka fish models, this approach generated a 297 bp deletion, 5 bp addition, and 1 bp mutation that resulted in premature termination of translation and complete loss of the seven transmembrane domains .

  • For conditional knockouts, the Cre-loxP system targeting exons encoding critical transmembrane domains can provide tissue-specific NPY2R deletion when appropriate Cre driver lines are employed.

Validation approaches:

  • Genotyping via PCR to confirm the presence of the intended genetic modification.

  • mRNA quantification using qRT-PCR to verify reduced NPY2R transcript levels .

  • Protein detection using Western blot and immunohistochemistry with NPY2R-specific antibodies to confirm absence of the receptor protein .

  • Functional validation through expected phenotypic changes such as altered feeding behavior, anxiety responses, or specific pathway activation (e.g., MAPK signaling) .

  • Control validations using blocking peptides in antibody-based detection methods to confirm specificity .

Comprehensive validation combining genetic, transcriptomic, proteomic, and functional assessments provides the strongest evidence for successful knockout generation.

How does NPY2R signaling contribute to kidney disease pathophysiology?

NPY2R signaling in kidney disease involves complex mechanisms that affect podocyte function and glomerular filtration:

The NPY-NPY2R signaling axis demonstrates a paradoxical pattern in kidney disease: local podocyte production of NPY decreases while circulating NPY levels increase . This imbalance appears to contribute to disease progression through several mechanisms:

  • Signaling cascade activation: In the glomerulus, NPY signals via NPY2R to modulate PI3K, MAPK, and NFAT signaling pathways . Prolonged activation of these pathways is associated with podocyte injury.

  • Proteomic alterations: Unbiased proteomic analysis revealed that glomerular NPY-NPY2R signaling predicts nephrotoxicity, modulates RNA processing, and inhibits cell migration . These changes likely contribute to podocyte dysfunction.

  • Therapeutic potential: Pharmacological inhibition of NPY2R in vivo significantly reduced albuminuria in adriamycin-treated glomerulosclerotic mice, independent of blood pressure effects . This suggests that targeting NPY2R may offer protection against kidney disease progression.

  • Structural preservation: NPY2R antagonism with BIIE0246 maintained podocyte foot process architecture in animal models, preserving the integrity of the glomerular filtration barrier .

These findings highlight NPY2R as a potential therapeutic target in albuminuric kidney diseases, with mechanistic insights suggesting that its inhibition may protect against podocyte injury and maintain filtration barrier integrity.

What is the role of NPY2R in neuropathic pain modulation?

NPY2R plays a significant role in pain processing and modulation through mechanisms centered in the amygdala:

Research using chronic constriction injury (CCI) models of the sciatic nerve has demonstrated that NPY2R in the amygdala contributes to neuropathic pain-like behaviors . The underlying mechanisms involve:

  • Aberrant expression: Both NPY and NPY2R are upregulated in neuropathic pain-related conditions, particularly in the basolateral amygdala (BLA) .

  • MAPK pathway activation: NPY2R activation stimulates the MAPK signaling pathway in the amygdala, a critical cascade in pain processing. Antagonism of this pathway restores normal pain thresholds as measured by mechanical withdrawal threshold (MWT) and thermal withdrawal latency (TWL) .

  • Microglial regulation: NPY2R overexpression promotes microglial viability while inhibiting apoptosis, suggesting neuroimmune mechanisms may contribute to pain sensitization .

  • Bidirectional central-peripheral signaling: The findings suggest that peripheral nerve injury leads to central adaptations in NPY-NPY2R signaling, which then contribute to persistent pain states through altered amygdala function.

These insights suggest that targeting NPY2R in the amygdala could offer a novel approach to managing neuropathic pain, particularly in cases where conventional analgesics provide inadequate relief.

How does NPY2R impact feeding behavior and metabolism?

NPY2R exerts significant influence on feeding behavior and metabolic regulation through multiple mechanisms:

Studies in NPY2R-deficient models have revealed pronounced effects on food intake and body composition:

  • Increased food consumption: NPY2R knockout medaka exhibited significantly increased food intake compared to wild-type controls . This enhanced appetite may reflect removal of inhibitory signals normally mediated by NPY2R.

  • Growth acceleration: NPY2R-deficient fish showed significantly increased total length and body weight compared to wild-type . This suggests that NPY2R normally serves as a brake on growth pathways.

  • Species conservation of function: The finding that NPY2R knockout in medaka increases food intake parallels observations in mammalian models, suggesting evolutionary conservation of NPY2R's role in appetite regulation across vertebrates .

  • Integration with other feeding circuits: NPY2R functions within a complex network of neuropeptides regulating food intake, including AgRP, POMC, and CCK. Studies examining expression changes in these factors following NPY2R manipulation provide insights into compensatory mechanisms .

  • Relationship to anxiety: NPY2R's dual role in regulating both feeding and anxiety behaviors suggests these functions may be mechanistically linked, potentially through shared neural circuits .

These findings highlight NPY2R as a potential therapeutic target for metabolic disorders, though careful consideration of potential side effects on anxiety and social behaviors would be necessary for any interventional approach.

How do I resolve contradictory findings between central and peripheral NPY2R signaling?

Reconciling apparently contradictory findings regarding NPY2R signaling requires considering several key factors:

  • Tissue-specific expression patterns: NPY2R may have opposite effects in different tissues. For example, in kidney disease, local NPY production by podocytes decreases while circulating NPY levels increase . This contrast suggests tissue-specific regulation that must be considered when interpreting results.

  • Methodological differences in receptor activation:

    • Acute vs. chronic stimulation: Short-term (10-minute) NPY treatment produces different proteomic changes than long-term (24-hour) exposure .

    • Concentration dependence: Different NPY concentrations may preferentially activate different receptor subtypes or signaling pathways.

    • Ligand specificity: Studies using full-length NPY versus specific NPY2R agonists may yield different results due to cross-activation of other NPY receptor subtypes.

  • Model system variables:

    • Species differences: While NPY2R function shows conservation across vertebrates, important differences exist between mammalian and non-mammalian models .

    • Genetic background: The impact of NPY2R manipulation may vary with the genetic background of the model organism.

    • Developmental timing: Constitutive versus inducible NPY2R knockout may produce different phenotypes due to developmental compensation.

  • Contextual factors:

    • Physiological state: The impact of NPY2R signaling may differ between healthy and disease states.

    • Environmental conditions: Stress, feeding status, and other environmental factors may modify NPY2R signaling outcomes.

To resolve contradictions, researchers should carefully control for these variables and consider employing multiple complementary approaches (e.g., pharmacological and genetic) in multiple model systems to build a more complete understanding of NPY2R function.

What controls should be included in NPY2R functional studies?

Robust NPY2R functional studies require comprehensive controls to ensure valid interpretation:

Genetic model controls:

  • Heterozygous comparisons: Include NPY2R+/- alongside NPY2R-/- and wild-type to assess gene dosage effects .

  • Rescue experiments: Re-expression of NPY2R in knockout models should reverse phenotypes if they are directly related to receptor loss.

  • Alternative knockout strategies: Using different targeting approaches (e.g., different CRISPR guide RNAs) helps confirm phenotypes are due to NPY2R loss rather than off-target effects.

Pharmacological controls:

  • Multiple specific antagonists: Using structurally diverse NPY2R antagonists (e.g., BIIE0246) helps confirm receptor specificity .

  • Dose-response relationships: Establish concentration-dependent effects to confirm specific receptor engagement.

  • Receptor blocking peptides: These can serve as negative controls in antibody-based detection methods .

Analytical controls:

  • Multiple detection methods: Combine RT-qPCR, Western blot, and immunostaining to confirm receptor expression changes .

  • Housekeeping gene selection: Validate multiple reference genes (e.g., β-actin) for expression normalization .

  • Statistical power: Ensure sufficient sample sizes based on power calculations to detect biologically meaningful differences.

Physiological controls:

  • Body weight measurements: Monitor for changes that might indirectly impact experimental outcomes, especially in feeding studies .

  • Blood pressure assessment: Rule out confounding cardiovascular effects in kidney-related studies .

  • Behavioral baseline measures: Establish normal ranges for behavioral parameters in anxiety and sociability assessments .

Implementation of these comprehensive controls strengthens the validity and reproducibility of NPY2R functional studies and facilitates comparison across different experimental systems.

How can species differences in NPY2R function be reconciled in translational research?

Reconciling species differences in NPY2R function requires systematic comparative approaches:

Understanding evolutionary conservation:

  • Sequence homology analysis: Compare NPY2R amino acid sequences across species to identify conserved functional domains versus divergent regions that might explain functional differences.

  • Signaling pathway conservation: Determine whether downstream effectors (PI3K, MAPK, NFAT) are similarly engaged by NPY2R across species .

  • Expression pattern mapping: Compare tissue distribution of NPY2R across species using comparable detection methods .

Methodological approaches:

  • Parallel model systems: Study NPY2R function simultaneously in multiple species (e.g., mouse, zebrafish, medaka) using identical experimental paradigms .

  • Humanized animal models: Generate mouse models expressing human NPY2R to directly assess functional differences.

  • Cross-species pharmacology: Compare pharmacological profiles of NPY2R ligands across species to identify conserved binding mechanisms.

Data integration strategies:

  • Molecular phenotyping: Use multi-omics approaches to characterize NPY2R signaling networks across species.

  • Behavioral homology: Identify behaviors that represent functional equivalents across species despite different manifestations.

  • Physiological endpoints: Focus on conserved physiological parameters (e.g., feeding regulation) rather than species-specific behaviors.

Translational considerations:

  • Pathway focus: When direct receptor functions differ, concentrate on conserved downstream pathways as translational targets.

  • Ligand development: Design NPY2R ligands targeting evolutionarily conserved binding domains to maximize cross-species applicability.

  • Context specification: Clearly delineate which aspects of NPY2R function are species-specific versus broadly conserved when designing translational studies.

By systematically addressing these considerations, researchers can develop more effective translational frameworks for NPY2R research that appropriately account for species differences while leveraging functional conservation.

What is the therapeutic potential of targeting NPY2R in different disease conditions?

The therapeutic potential of NPY2R modulation spans multiple disease areas:

Kidney disease:

  • NPY2R antagonism (e.g., with BIIE0246) significantly reduced albuminuria and preserved podocyte foot process architecture in adriamycin-induced nephropathy models .

  • These protective effects occurred independently of blood pressure changes, suggesting direct renoprotective mechanisms .

  • Future therapeutic development could focus on kidney-targeted NPY2R antagonists to minimize systemic effects.

Neuropathic pain:

  • NPY2R in the amygdala contributes to pain sensitivity via MAPK pathway activation .

  • Localized NPY2R antagonism in pain-processing brain regions represents a potential novel approach for treating neuropathic pain resistant to conventional analgesics.

  • Combinatorial approaches targeting NPY2R alongside established pain pathways might offer synergistic benefits.

Metabolic disorders:

  • NPY2R's role in feeding regulation suggests potential applications in obesity and metabolic syndrome .

  • The complex relationship between NPY2R, food intake, and anxiety requires carefully balanced therapeutic approaches.

  • Conditional or tissue-specific modulation might help separate beneficial metabolic effects from unwanted neuropsychiatric impacts.

Oncology applications:

  • The high frequency and density of NPY receptors in steroid hormone-producing tumors suggests potential applications in tumor management .

  • NPY2R-targeted imaging agents could improve tumor detection and monitoring.

  • Cytotoxic payloads conjugated to NPY2R ligands might enable targeted tumor therapy.

As research progresses, therapeutic development will need to address challenges including receptor subtype selectivity, tissue-specific delivery, and management of effects across multiple physiological systems regulated by NPY2R.

How does NPY2R interact with other signaling systems in integrated physiological responses?

NPY2R functions within complex signaling networks that coordinate integrated physiological responses:

Neuroendocrine interactions:

  • Glucocorticoid system: Studies have examined interactions between NPY2R and glucocorticoid receptors (GR1, GR2) and mineralocorticoid receptors (MR), suggesting coordinated stress and metabolic regulation .

  • Serotonergic pathways: NPY2R interacts with tryptophan hydroxylase (TH1, TH2) expression, linking NPY signaling to serotonin production and mood regulation .

Feeding circuit integration:

  • Appetite regulation network: NPY2R functions alongside other key regulators including AgRP, POMC, CCK, and NPY itself to form a coordinated feeding circuit .

  • Counter-regulatory mechanisms: When NPY2R is deleted, compensatory changes in other appetite-regulating genes help maintain energy homeostasis.

Kidney signaling crosstalk:

  • PI3K/MAPK/NFAT integration: NPY2R activation modulates these key signaling pathways that also respond to other renal regulatory factors, creating complex signaling nodes .

  • Proteomic network effects: High-resolution proteomics has revealed that NPY-NPY2R signaling influences a broad array of proteins involved in RNA processing, cell migration, and nephrotoxicity responses .

Pain processing circuits:

  • Amygdala microcircuits: NPY2R influences microglial viability and apoptosis, affecting neuroimmune interactions crucial for pain processing .

  • MAPK pathway convergence: Multiple pain mediators converge on MAPK signaling, with NPY2R representing one regulatory input among many .

Understanding these complex interactions requires systems biology approaches that can map the full scope of NPY2R's influence across multiple signaling networks and physiological systems.

What emerging technologies are advancing NPY2R research?

Several cutting-edge technologies are transforming NPY2R research capabilities:

Genetic engineering advancements:

  • CRISPR/Cas9 precision editing: Beyond simple knockouts, precision editing now enables subtle modifications of NPY2R regulatory elements and specific domains to dissect receptor function with unprecedented resolution .

  • Cell-specific manipulation: Combinatorial approaches using Cre-driver lines with floxed NPY2R alleles allow investigation of receptor function in specific cell populations.

  • Inducible systems: Temporally controlled NPY2R manipulation helps distinguish developmental versus acute receptor functions.

Advanced imaging techniques:

  • GPCR conformational biosensors: These allow real-time visualization of NPY2R activation states in living cells.

  • Tissue clearing methods: Technologies like CLARITY and iDISCO enable whole-organ imaging of NPY2R distribution across intact neural and renal tissues.

  • Multiplexed receptor visualization: Methods to simultaneously image multiple receptor types reveal how NPY2R spatially interacts with other signaling components.

High-dimensional analytical methods:

  • Single-cell transcriptomics: This reveals cell-specific NPY2R expression patterns and responses across heterogeneous tissues.

  • High-resolution mass spectrometry: Tandem Mass Tagged (TMT)-based proteomics enables comprehensive analysis of NPY2R-mediated protein changes .

  • Spatial transcriptomics: These techniques map NPY2R expression with spatial context in complex tissues.

Pharmacological innovations:

  • Biased ligand development: Creation of ligands that selectively activate specific NPY2R signaling pathways while avoiding others.

  • PET ligands for NPY2R: Development of positron emission tomography tracers allows in vivo imaging of receptor distribution and occupancy.

  • Targeted nanoparticle delivery: These systems enable tissue-specific delivery of NPY2R modulators.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.