Recombinant Mouse Ninjurin-1 (Ninj1)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Physiology and Disease

Ninjurin-1 mediates cell-cell interactions and inflammatory responses:

  • Inflammation Regulation:

    • Promotes macrophage activation via homophilic interactions with injured alveolar epithelial cells, exacerbating pulmonary fibrosis .

    • Soluble Ninj1 (sNinj1), generated by MMP-9 cleavage, inhibits monocyte transendothelial migration and reduces atherosclerosis by blocking cell adhesion .

  • Plasma Membrane Rupture (PMR):

    • Oligomerizes during pyroptosis/apoptosis to mediate PMR, releasing DAMPs (e.g., HMGB1, IL-18) . Anti-Ninj1 antibodies (e.g., clone D1) block oligomerization, reducing tissue injury .

  • Nerve Regeneration:

    • Upregulated after nerve injury, facilitating Schwann cell adhesion and axonal growth .

Research Applications

Recombinant Mouse Ninj1 is widely used in mechanistic and therapeutic studies:

  • Disease Models:

    • Pulmonary Fibrosis: Ninj1 knockout (KO) mice show reduced fibrosis severity, implicating Ninj1 in macrophage-epithelial cell crosstalk .

    • Atherosclerosis: sNinj1-mimetic peptides (ML56, PN12) attenuate macrophage inflammation and lesion formation .

    • Liver Injury: Anti-Ninj1 antibodies mitigate hepatocellular PMR in ischemia-reperfusion and toxin-induced injury .

  • Structural Studies:

    • Electron microscopy reveals Ninj1 forms oligomeric filaments (arcs, rings) during PMR, which are disrupted by inhibitory antibodies .

  • Drug Development:

    • Clone D1 antibody prevents Ninj1 oligomerization, serving as a template for therapeutics targeting inflammatory diseases .

Key Research Findings

StudyModel/SystemKey Insight
Ninj1 in Pulmonary FibrosisBLM-induced mouse modelNinj1 KO reduces fibrotic severity by blocking macrophage-AEC interactions .
sNinj1 in AtherosclerosisApoe−/− micesNinj1 peptides reduce monocyte recruitment and plaque formation .
Anti-Ninj1 Antibody EffectsBMDMs, HEK293T cellsClone D1 antibody inhibits PMR by disrupting Ninj1 oligomers .
Nerve Injury MechanismDorsal root ganglion cellsRecombinant Ninj1 promotes neurite outgrowth via homophilic adhesion .

Product Specs

Buffer
For liquid delivery forms, the default storage buffer is a Tris/PBS-based buffer containing 5%-50% glycerol. For lyophilized powder delivery forms, the buffer used before lyophilization is a Tris/PBS-based buffer containing 6% Trehalose.
Form
Liquid or Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method or location. For specific delivery timelines, please consult your local distributors.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein. Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
N-terminal 10xHis-tagged
Datasheet & Coa
Please contact us to get it.
Expression Region
1-152aa
Mol. Weight
18.1 kDa
Protein Length
Full Length
Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Neuroscience
Source
in vitro E.coli expression system
Species
Mus musculus (Mouse)
Target Names
Ninj1
Target Protein Sequence
MESGTEEYELNGDLRPGSPGSPDALPPRWGLRNRPINVNHYANKKSAAESMLDIALLMANASQLKAVVEQGNDFAFFVPLVVLISISLVLQIGVGVLLIFLVKYDLNNPAKHAKLDFLNNLATGLVFIIVVVNIFITAFGVQKPVMDVAPRQ
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Uniprot No.

Target Background

Function
Ninjurin-1 (Ninj1) is a homophilic transmembrane adhesion molecule involved in various biological processes, including inflammation, cell death, axonal growth, cell chemotaxis, and angiogenesis. It facilitates cell adhesion by mediating homophilic interactions via its extracellular N-terminal adhesion motif (N-NAM). Ninj1 plays a role in the progression of inflammatory stress by promoting cell-to-cell interactions between immune cells and endothelial cells. It contributes to leukocyte migration during inflammation by facilitating the transendothelial migration of macrophages through homotypic binding. Furthermore, Ninj1 promotes the migration of monocytes across the brain endothelium to central nervous system inflammatory lesions. It acts as a regulator of Toll-like receptor 4 (TLR4) signaling triggered by lipopolysaccharide (LPS) during systemic inflammation, directly binding LPS. Ninj1 serves as a mediator of both programmed and necrotic cell death. It plays a crucial role in inducing plasma membrane rupture during programmed and necrotic cell death. In response to death stimuli, Ninj1 oligomerizes, mediating plasma membrane rupture (cytolysis), leading to the release of intracellular molecules called damage-associated molecular patterns (DAMPs) that propagate the inflammatory response. Ninj1 also participates in nerve regeneration by promoting the maturation of Schwann cells and acts as a regulator of angiogenesis. It promotes the formation of new vessels by mediating the interaction between capillary pericyte cells and endothelial cells. Additionally, Ninj1 mediates vascular functions in penile tissue and vascular formation. It promotes osteoclast development by enhancing the survival of prefusion osteoclasts. Ninj1 is also involved in striated muscle growth and differentiation. It contributes to cell senescence in a p53/TP53-dependent manner, potentially by acting as an indirect regulator of p53/TP53 mRNA translation. A secreted form of Ninj1, generated by cleavage, exhibits chemotactic activity. This secreted form acts as an anti-inflammatory mediator by promoting monocyte recruitment, thereby mitigating atherosclerosis.
Gene References Into Functions
  1. Ninjurin1 is a critical regulatory molecule for macrophage migration and Tumor-associated macrophage (TAM) mediated tumorigenesis in vivo. PMID: 27127177
  2. Research indicates that Ninj1 assembles into a homomeric protein complex, and N-glycosylation is essential for Ninj1 homomer assembly. PMID: 28067406
  3. Ninj1 negatively regulates the formation of new blood vessels (EC-tube) by reducing the trophic effects of capillary pericytes. PMID: 25766274
  4. Ninj1 modulates TLR4 signaling, which plays a significant role in systemic inflammatory response syndrome and sepsis. PMID: 25860173
  5. Bone marrow-derived macrophages deficient in Ninjurin1 exhibit reduced membrane protrusion formation and dynamics, impairing cell motility. PMID: 24917672
  6. Inhibition of Ninjurin 1 restores erectile function through dual angiogenic and neurotrophic effects in diabetic mice. PMID: 24979788
  7. The dual neurotrophic and angiogenic effects of Ninj1 blockade may offer a promising approach for treating erectile dysfunction arising from radical prostatectomy. PMID: 23551591
  8. Ninjurin1 deficiency attenuates susceptibility to experimental autoimmune encephalomyelitis in mice. PMID: 24347169
  9. Ninj1 plays a role in p53-mediated tumor suppression alongside its function in nerve regeneration. PMID: 23690620
  10. The N-terminal ectodomain of mouse Ninjurin1, potentially acting as a chemoattractant, is cleaved by MMP9. PMID: 23142597
  11. Ninj1 protein plays a crucial role in macrophage-mediated vascular regression during early eye development, suggesting its biological relevance in vascular homeostasis. PMID: 19557008

Show More

Hide All

Database Links
Protein Families
Ninjurin family
Subcellular Location
[Ninjurin-1]: Cell membrane; Multi-pass membrane protein. Cell junction, synapse, synaptic cell membrane; Multi-pass membrane protein.; [Secreted ninjurin-1]: Secreted.

Q&A

What is the basic structure and function of mouse Ninjurin-1?

Mouse Ninjurin-1 is a 17-kDa transmembrane homophilic cell adhesion molecule with two transmembrane domains and both N and C termini located extracellularly. It contains four α-helical structures (α1-α4) in its structured region (residues 39-141) . The protein's N-terminal domain (residues 1-80) contains the homophilic binding domain (residues 26-37) that mediates cell-cell adhesion . Mouse Ninjurin-1 is expressed in various tissues, with higher expression in skin, ileum, sciatic nerve, spleen, and lung, and moderate expression in stomach, colon, liver, pancreas, kidney, and testis .

The primary functions of Ninjurin-1 include:

  • Mediating homophilic cell adhesion

  • Promoting transendothelial migration (TEM) of leukocytes

  • Regulating inflammatory responses

  • Mediating plasma membrane rupture (PMR) during lytic cell death

How can I produce recombinant mouse Ninjurin-1 for research use?

Recombinant mouse Ninjurin-1 can be produced using standard molecular cloning and protein expression systems. The methodology typically involves:

  • Gene amplification: Use PCR to amplify the gene encoding Ninj1 (full-length or specific domains)

  • Cloning: Insert the amplified gene into an appropriate expression vector (e.g., pCS2+ or pEGFP)

  • Expression system selection: E. coli or mammalian cell lines (e.g., Expi293F) can be used

  • Protein purification: Extract using detergents for membrane proteins (e.g., DDM) followed by chromatography

  • Quality control: Verify protein integrity using SDS-PAGE and Western blotting

For the extracellular domain (rmNinj1 1–50), researchers have successfully generated recombinant protein as described in previous publications . This domain covers the homophilic binding region critical for Ninjurin-1 function .

What are the commonly used experimental models to study Ninjurin-1 function?

Several experimental models have been established to study Ninjurin-1 function:

In vivo models:

  • Ninj1 knockout (KO) mice: Generated by removing exon 1 from the four exons encoding Ninjurin-1 on chromosome 13 using homologous recombination

  • Disease-specific models:

    • Bleomycin-induced pulmonary fibrosis

    • Experimental autoimmune encephalomyelitis (EAE) for multiple sclerosis

    • Endotoxin-induced uveitis

    • Atherosclerosis models using Apoe−/− or Ldlr−/− mice

In vitro models:

  • Raw264.7 macrophage cell line (wild-type or with Ninj1 overexpression/knockdown)

  • Bone marrow-derived macrophages (BMDMs) from wild-type or Ninj1 KO mice

  • MLE-12 (pneumocyte cell line)

  • MBEC4 endothelial cells

How do the different domains of recombinant mouse Ninjurin-1 contribute to its various functions?

Mouse Ninjurin-1 has several functional domains with distinct contributions to its biological activities:

DomainResiduesFunctionsResearch Applications
N-terminal extracellular domain1-71Contains homophilic binding motif; not involved in LPS bindingMediating cell-cell adhesion; targets for blocking antibodies
Homophilic binding motif26-37Critical for homophilic binding and cell adhesionPeptide mimetics (PN12) for therapeutic applications
First transmembrane domain72-100Contains LPS binding region (81-100)Studying TLR4-independent inflammatory responses
Cytosolic domain101-117Signal transductionInvestigating intracellular signaling
Second transmembrane domain118-139Structural support; involved in oligomerizationStudying PMR mechanisms
C-terminal extracellular domain140-152Contribution to protein stabilityProtein engineering applications

The homophilic binding motif (26-37) is particularly important in mediating cell-cell adhesion and transendothelial migration of leukocytes . Targeting this region with specific antibodies or peptide mimetics can modulate inflammatory responses . The first transmembrane domain (residues 81-100) has been identified as the LPS binding region, suggesting a role in LPS-induced inflammation independent of traditional TLR4 signaling .

Research has shown that recombinant mouse Ninj1 1-50 protein, which contains the homophilic binding domain, can trigger inflammatory responses in wild-type macrophages but not in Ninj1-deficient macrophages . This indicates the specificity of this domain in mediating Ninj1-dependent inflammation.

What are the molecular mechanisms underlying Ninjurin-1's dual role in inflammation?

Ninjurin-1 exhibits a complex, context-dependent role in inflammation, demonstrating both pro-inflammatory and anti-inflammatory properties depending on its form (membrane-bound vs. soluble) and the specific disease model:

Pro-inflammatory mechanisms:

  • Homophilic binding between Ninjurin-1 molecules facilitates leukocyte adhesion and transendothelial migration

  • Full-length Ninjurin-1 enhances contact-dependent activation of macrophages when interacting with alveolar epithelial cells

  • Recombinant Ninjurin-1 (1-50) can trigger NF-κB signaling pathway activation and increase IL-1β expression in wild-type macrophages

  • Ninjurin-1 binding to LPS contributes to inflammatory responses via residues 81-100

  • During lytic cell death, Ninjurin-1 mediates plasma membrane rupture, releasing DAMPs that amplify inflammation

Anti-inflammatory mechanisms:

  • Soluble Ninjurin-1 (sNinj1), generated by MMP9 cleavage, blocks homophilic binding and reduces monocyte transendothelial migration

  • The sNinj1-mimetic peptides (ML56 and PN12) exhibit atheroprotective effects by inhibiting macrophage-mediated inflammation

  • Soluble Ninjurin-1 activates the phosphoinositide 3-kinase/Akt signaling pathway, which suppresses inflammatory gene expression

This dual role helps explain contradictory results observed in different disease models when studying Ninjurin-1 deficiency. In EAE models, Ninjurin-1 deficiency is protective due to reduced leukocyte infiltration , while in atherosclerosis models, Ninjurin-1 deficiency exacerbates disease by reducing anti-inflammatory sNinj1 levels .

How does recombinant Ninjurin-1 oligomerization contribute to plasma membrane rupture during cell death?

Recent studies have revealed that Ninjurin-1 undergoes oligomerization to form filamentous structures that mediate plasma membrane rupture (PMR) during lytic cell death:

  • Structural basis: Cryo-electron microscopy has revealed that human NINJ1 forms filaments with an interval of 20.95 Å and a slight rotation of -1.05° per subunit. The structured region (residues 39-141) comprises four α-helices (α1-α4) that participate in both intramolecular and intermolecular interactions .

  • Oligomerization process: During lytic cell death, Ninjurin-1 molecules cluster in the plasma membrane, forming oligomeric structures including rings, filaments, clusters, and arcs up to 200 nm in size. This clustering is dependent on the four α-helical structures .

  • Functional validation: Mutational analysis targeting intermolecular interfaces (K45Q, D53A, G95L, T123L, I134F, A138L) and intramolecular interfaces (I84F, Q91A) disrupts filament formation and prevents cell lysis upon Ninjurin-1 overexpression .

  • Therapeutic targeting: Anti-NINJ1 monoclonal antibodies that bind to mouse NINJ1 prevent oligomerization by blocking formation of oligomeric filaments, thereby inhibiting PMR. This approach has shown protective effects in models of hepatocellular injury by reducing the release of DAMPs and subsequent inflammation .

The highly conserved nature of this mechanism across different forms of lytic cell death (pyroptosis, necroptosis, apoptosis) suggests that Ninjurin-1-mediated PMR represents a common final pathway in these processes, making it an attractive therapeutic target for conditions characterized by excessive cell death and inflammation .

How can I design experiments to evaluate the efficiency of recombinant Ninjurin-1 in modulating macrophage activation?

To evaluate the efficiency of recombinant mouse Ninjurin-1 in modulating macrophage activation, consider the following experimental approaches:

In vitro assays:

  • Macrophage activation assessment:

    • Treat wild-type and Ninj1-deficient macrophages (RAW264.7 or BMDMs) with different concentrations of rmNinj1 (10-50 μg/ml)

    • Evaluate activation markers: phosphorylation of NF-κB p65, expression of pro-inflammatory cytokines (IL-1β, TNF-α)

    • Measure nitric oxide production and iNOS expression

  • Signaling pathway analysis:

    • Investigate activation of MAPK pathway (p-ERK, p-JNK, p-p38)

    • Assess PI3K/Akt signaling (p-Akt)

    • Compare responses in wild-type vs. Ninj1-deficient macrophages

  • Domain-specific effects:

    • Compare effects of different rmNinj1 constructs: full-length, N-terminal domain (1-50), transmembrane domains

    • Use blocking antibodies targeting specific epitopes (e.g., homophilic binding domain)

In vivo validation:

  • Adoptive transfer experiments:

    • Pre-treat monocytes with rmNinj1 or vehicle

    • Transfer to recipient mice with inflammatory condition (e.g., atherosclerosis, EAE)

    • Evaluate monocyte recruitment and tissue inflammation

  • Direct administration:

    • Inject rmNinj1 or domain-specific peptides (e.g., PN12)

    • Assess disease progression in models of inflammatory diseases

    • Compare responses in wild-type vs. Ninj1-deficient mice

Key controls and considerations:

  • Include both wild-type and Ninj1-deficient macrophages to confirm specificity

  • Use heat-inactivated rmNinj1 as control for possible endotoxin contamination

  • Compare effects with established TLR ligands (e.g., LPS) to distinguish mechanisms

  • Consider potential soluble vs. membrane-bound effects

How do I reconcile contradictory findings regarding Ninjurin-1's role in different disease models?

The contradictory findings regarding Ninjurin-1's role in different disease models can be reconciled by considering several key factors:

  • Membrane-bound vs. soluble forms:

    • Membrane-bound Ninjurin-1 generally promotes inflammation through homophilic binding and leukocyte recruitment

    • Soluble Ninjurin-1 (sNinj1), generated by MMP9 cleavage, has anti-inflammatory properties by blocking homophilic interactions

    • Disease-specific expression of MMP9 may determine the ratio of these forms

  • Cell type-specific expression:

    • Ninjurin-1 expression varies greatly among cell types and tissues

    • In central nervous system inflammation, endothelial Ninjurin-1 mediates leukocyte infiltration

    • In atherosclerosis, macrophage-derived Ninjurin-1 (particularly sNinj1) has anti-inflammatory effects

    • In pulmonary fibrosis, Ninjurin-1 in both macrophages and alveolar epithelial cells contributes to disease progression

  • Functional contexts:

    • Cell adhesion: Ninjurin-1 promotes cell-cell adhesion via homophilic binding

    • Plasma membrane rupture: Ninjurin-1 oligomerization mediates PMR during cell death

    • Inflammation modulation: Context-dependent effects on inflammatory signaling

    • LPS response: Direct binding to LPS may contribute to inflammatory responses

  • Methodological considerations:

    • Global vs. cell-specific knockout models may yield different results

    • Timing of intervention (preventive vs. therapeutic) affects outcomes

    • Different readouts (e.g., clinical scores vs. molecular markers) may highlight different aspects of Ninjurin-1 function

Research approaches to reconcile these contradictions include:

  • Generating cell type-specific conditional knockout models

  • Simultaneously measuring membrane-bound and soluble Ninjurin-1 levels

  • Developing antibodies that specifically target either form

  • Comparative studies across multiple disease models using standardized protocols

How do I establish and validate Ninjurin-1 knockout or knockdown models for my research?

Establishing and validating Ninjurin-1 knockout or knockdown models requires careful attention to methodology to ensure specificity and effectiveness:

Generation of Ninj1 knockout mice:

  • Target exon 1 from the four exons encoding Ninjurin-1 on chromosome 13 using homologous recombination

  • Genotype using PCR with the following primers:

    • Wild type (forward): 5′-GAG ATA GAG GGA GCA CGA CG-3′

    • Neo (forward): 5′-ACG CGT CAC CTT AAT ATG CG-3′

    • Reverse primer: 5′-CGG GTT GTT GAG GTC ATA CTT G-3′

  • Backcross with C57BL/6 for at least seven generations to establish a pure background

Cell-specific Ninj1 knockdown:

  • Design siRNAs targeting mouse Ninjurin-1 (NM_013610)

    • Example sequence: 5′-ACC GGC CCA TCA ATG TAA ACC AUU A-3′

  • Transfect cells using appropriate methods:

    • For macrophages (RAW264.7), use Nucleofector (Amaxa) at <200 pmol per sample

    • For other cell types, adjust transfection method accordingly

  • Confirm knockdown efficiency by Western blotting 24 hours post-transfection

Validation strategies:

  • Genetic validation:

    • PCR genotyping to confirm gene deletion

    • Sequencing to verify the exact modification

  • Protein expression validation:

    • Western blotting using specific antibodies (e.g., Ab 1-15)

    • Immunohistochemistry to assess tissue-specific expression

    • Flow cytometry for cell surface expression

  • Functional validation:

    • Assess adhesion properties using co-culture systems

    • Evaluate inflammatory responses to stimuli (e.g., LPS, rmNinj1 1-50)

    • Compare PMR during lytic cell death between wild-type and knockout cells

  • Phenotypic characterization:

    • Perform hemogram analysis to ensure normal blood parameters

    • Assess baseline inflammatory markers

    • Monitor for developmental abnormalities (note: some Ninj1 KO mice may show developmental retardation or dysfunctions)

How can I accurately measure the binding affinities between recombinant Ninjurin-1 and its interacting partners?

To accurately measure binding affinities between recombinant mouse Ninjurin-1 and its interacting partners, researchers can employ several biophysical and biochemical techniques:

Surface Plasmon Resonance (SPR):

  • Immobilize purified rmNinj1 on a sensor chip

  • Flow potential binding partners at varying concentrations

  • Measure association (ka) and dissociation (kd) rates

  • Calculate equilibrium dissociation constant (KD = kd/ka)

  • This approach is particularly useful for studying homophilic Ninj1-Ninj1 interactions and interactions with LPS

Bio-Layer Interferometry (BLI):

  • Similar to SPR but uses optical interference patterns

  • Can be performed with lower sample amounts

  • Useful for membrane proteins like Ninjurin-1

Microscale Thermophoresis (MST):

  • Based on the directed movement of molecules in microscopic temperature gradients

  • Requires fluorescent labeling of one binding partner

  • Works well for membrane proteins and in complex solutions

Pull-down assays:

  • For LPS binding studies, use biotinylated LPS and streptavidin beads

  • Incubate with cell lysates expressing wild-type or truncated Ninjurin-1 constructs

  • Analyze bound proteins by Western blotting

  • This approach was successfully used to identify the LPS binding region (aa 81-100)

Cell-based adhesion assays:

  • Express GFP-tagged Ninjurin-1 in one cell population

  • Express another binding partner (or Ninjurin-1 itself for homophilic binding) in another cell population

  • Measure adhesion strength or frequency

  • Use blocking antibodies or peptides as competitive inhibitors to verify specificity

Important considerations:

  • The membrane-embedded nature of Ninjurin-1 makes traditional solution-based affinity measurements challenging

  • Detergent selection is critical when working with purified Ninjurin-1 (DDM has been used successfully)

  • Recombinant protein fragments (e.g., rmNinj1 1-50) may exhibit different binding properties than the full-length protein

  • Appropriate controls (e.g., heat-inactivated protein, irrelevant proteins) should be included

What are the best approaches to study Ninjurin-1's role in transendothelial migration in vitro?

Studying Ninjurin-1's role in transendothelial migration (TEM) in vitro requires carefully designed experimental systems that recapitulate the cellular interactions occurring during leukocyte recruitment:

Transwell migration assays:

  • Culture endothelial cells (e.g., MBEC4, bEnd.3) on transwell inserts until confluent

  • Verify endothelial barrier integrity using TEER measurements or FITC-dextran permeability

  • Apply macrophages or monocytes (wild-type, Ninj1 KO, or with modulated Ninj1 expression) to the upper chamber

  • Add chemoattractants (e.g., MCP-1) to the lower chamber

  • Quantify migrated cells after 2-24 hours by microscopy or flow cytometry

Microfluidic systems:

  • Culture endothelial cells in microfluidic channels under flow conditions

  • Apply fluorescently labeled monocytes/macrophages under physiological shear stress

  • Monitor the different stages of TEM (rolling, adhesion, transmigration) in real-time

  • This approach allows visualization of Ninjurin-1's role in specific stages of TEM

ECIS (Electric Cell-substrate Impedance Sensing):

  • Grow endothelial monolayers on gold electrodes

  • Monitor barrier function through impedance measurements

  • Add monocytes/macrophages and track impedance changes during TEM

  • This provides quantitative, real-time data on the kinetics of TEM

Experimental manipulations to assess Ninjurin-1's role:

  • Genetic approaches:

    • Compare TEM of wild-type vs. Ninj1 KO macrophages/monocytes

    • Use siRNA to knockdown Ninj1 in either endothelial cells or leukocytes

    • Overexpress GFP-tagged Ninj1 to assess effect on TEM activity

  • Pharmacological interventions:

    • Apply blocking antibodies targeting the Ninj1 homophilic binding domain (aa 26-37)

    • Use rmNinj1 1-50 or peptide mimetics (PN12) to compete with cell-surface Ninj1

    • Add soluble Ninj1 (sNinj1) to assess its inhibitory effects on TEM

  • Analysis parameters:

    • Quantify total transmigrated cells

    • Measure velocity and directionality of migration

    • Assess morphological changes (filopodia, lamellipodia formation)

    • Monitor adhesion molecule clustering at the cell surface

Research has demonstrated that TEM activity decreases in Ninj1 KO bone marrow-derived macrophages and siNinj1 RAW264.7 cells, while GFP-tagged mNinj1-overexpressing RAW264.7 cells show increased TEM . These findings highlight Ninjurin-1's important role in facilitating leukocyte transmigration across endothelial barriers.

How is Ninjurin-1 involved in the regulation of plasma membrane rupture during different forms of cell death?

Ninjurin-1's role in plasma membrane rupture (PMR) represents a paradigm shift in our understanding of cell death mechanisms:

Mechanism across different cell death pathways:

  • Ninjurin-1 mediates PMR in multiple forms of lytic cell death, including:

    • Pyroptosis (NLRP3 inflammasome activation)

    • Necroptosis (TNF-induced)

    • Late-stage apoptosis

    • Other forms (ferroptosis, parthanatos, cuproptosis, H₂O₂-induced necrosis)

  • The molecular mechanism involves:

    • Clustering of NINJ1 within the plasma membrane

    • Formation of oligomeric structures (rings, filaments, clusters, arcs)

    • NINJ1 oligomerization dependent on four α-helical structures (α1-α4)

    • Creation of membrane disruptions allowing cytoplasmic content release

  • Regulation of this process:

    • Glycine treatment inhibits NINJ1 clustering, maintaining membrane integrity

    • Muscimol blocks NINJ1 oligomerization, preventing PMR during pyroptosis

    • Anti-NINJ1 antibodies prevent oligomerization by blocking filament formation

Physiological and pathological significance:

  • PMR represents the final catastrophic event of lytic cell death, not merely a passive process

  • Release of damage-associated molecular patterns (DAMPs) through PMR amplifies inflammation

  • Inhibiting NINJ1-mediated PMR reduces inflammation and tissue damage in various disease models

  • This mechanism is evolutionarily conserved, suggesting fundamental importance

Research approaches:

  • Live-cell imaging with fluorescent markers to visualize membrane integrity

  • LDH release assays to quantify membrane permeabilization

  • NINJ1 clustering visualization using fluorescently tagged NINJ1

  • Electron microscopy to study NINJ1 filament formation

  • Mutational analysis targeting oligomerization interfaces

This research area represents a significant advance in our understanding of cell death mechanisms, transforming what was once considered a passive process into a regulated event with therapeutic potential. Targeting NINJ1-mediated PMR may offer new strategies for treating conditions characterized by excessive cell death and inflammation.

What are the latest developments in understanding the therapeutic potential of Ninjurin-1 targeting in inflammatory diseases?

Recent research has revealed multiple approaches for therapeutically targeting Ninjurin-1 in inflammatory diseases, with promising results in several preclinical models:

Anti-inflammatory strategies:

  • Blocking antibodies:

    • Antibodies targeting the homophilic binding domain (aa 26-37) reduce leukocyte infiltration in EAE

    • Anti-NINJ1 monoclonal antibodies that prevent oligomerization protect against liver injury by inhibiting PMR and DAMP release

    • High-dose NINJ1-Ab induces restoration of function in cavernous nerve injury models

  • Soluble Ninjurin-1 mimetics:

    • Recombinant mouse Ninj1 1-56 protein (ML56) exhibits anti-inflammatory effects in atherosclerosis models

    • The peptide Ninj1 26-37 (PN12), which mimics sNinj1, significantly attenuates atherosclerotic lesion formation

    • These mimetics function by blocking homophilic binding and inhibiting monocyte transendothelial migration

  • Small molecule inhibitors:

    • Glycine inhibits NINJ1 clustering within the plasma membrane

    • Muscimol blocks oligomerization of NINJ1 and reduces lethality during LPS-induced septic shock

Disease-specific applications:

  • Neuroinflammatory conditions:

    • In EAE (multiple sclerosis model), Ninjurin-1 blockade decreases leukocyte infiltration and attenuates clinical symptoms

    • The N-terminal adhesion motif (N-NAM) augments angiogenesis in the ischemic brain and enhances neuroprotection

  • Cardiovascular disease:

    • sNinj1 and its mimetic peptides exhibit atheroprotective effects by regulating macrophage inflammation

    • These approaches reduce monocyte recruitment and lesion formation in atherosclerosis models

  • Pulmonary fibrosis:

    • Blocking Ninj1-mediated interactions between macrophages and alveolar epithelial cells may reduce inflammatory activation and fibrosis progression

  • Liver injury:

    • Anti-NINJ1 antibodies ameliorate hepatocellular PMR in multiple liver injury models

    • This approach reduces serum levels of DAMPs and liver enzymes, and decreases neutrophil infiltration

Emerging therapeutic considerations:

  • Cell type-specific targeting may be necessary given Ninjurin-1's diverse functions

  • The dual pro- and anti-inflammatory roles of Ninjurin-1 require careful consideration of context

  • Timing of intervention is critical, as the therapeutic window may vary by disease

  • Combination approaches targeting both membrane-bound and soluble forms may offer synergistic benefits

These developments highlight Ninjurin-1 as a promising therapeutic target for various inflammatory diseases, with multiple approaches showing efficacy in preclinical models. Further research is needed to translate these findings to clinical applications.

How can recombinant Ninjurin-1 be engineered to enhance specific functions or target particular cell types?

Engineering recombinant mouse Ninjurin-1 for enhanced functionality or targeted delivery represents an emerging frontier in research:

Domain-specific modifications:

  • Homophilic binding domain (aa 26-37):

    • Amino acid substitutions to enhance or reduce binding affinity

    • Fusion with cell-penetrating peptides for intracellular delivery

    • Cyclization to increase stability and binding specificity

    • This domain is critical for cell adhesion functions

  • LPS binding region (aa 81-100):

    • Modifications to alter LPS binding affinity

    • Engineering to compete with TLR4 for LPS binding

    • This domain mediates direct interactions with LPS

  • Oligomerization interfaces:

    • Targeted mutations in helices α1-α4 to enhance or inhibit filament formation

    • Engineering conditional oligomerization (e.g., pH-sensitive, protease-activated)

    • These modifications would affect PMR activity

Fusion protein approaches:

  • Cell-targeting moieties:

    • Fusion with antibody fragments (scFv) for cell type-specific targeting

    • Addition of peptides that bind to specific receptors (e.g., integrins)

    • These approaches could direct Ninjurin-1 activity to particular cell populations

  • Functional domains:

    • Fusion with cytokine domains for immunomodulatory effects

    • Engineering bifunctional molecules (e.g., Ninjurin-1-TIMP to inhibit both adhesion and MMP activity)

    • Addition of fluorescent tags for real-time tracking without compromising function

  • Soluble vs. membrane-anchored forms:

    • Engineering soluble forms with enhanced stability

    • Creating membrane-anchored variants with controlled release mechanisms

    • These modifications could modulate the balance between pro- and anti-inflammatory effects

Post-translational modifications:

  • Glycosylation engineering:

    • Modification of glycosylation patterns to alter stability and activity

    • Ninjurin-1 undergoes glycosylation as a post-translational modification

  • Protease-resistant variants:

    • Engineering resistance to MMP9 cleavage to maintain membrane-bound form

    • Creating variants with enhanced susceptibility to specific proteases for controlled release

Delivery systems:

  • Nanoparticle encapsulation:

    • Incorporation into liposomes or polymeric nanoparticles

    • Surface modification with targeting moieties

    • Controlled release formulations

  • Gene delivery approaches:

    • Viral vectors for cell-specific expression

    • mRNA delivery for transient expression

    • CRISPR-based approaches for endogenous gene modification

These engineering approaches could enable precise modulation of Ninjurin-1 functions in specific cellular contexts, potentially enhancing therapeutic applications while minimizing off-target effects.

What are the unexplored aspects of Ninjurin-1 biology that warrant further investigation?

Despite significant advances in understanding Ninjurin-1 biology, several key aspects remain unexplored or incompletely characterized:

  • Signaling mechanisms:

    • Intracellular signaling pathways activated by Ninjurin-1 homophilic binding

    • Potential role as a direct signaling receptor beyond adhesion functions

    • Cross-talk with other inflammatory pathways (TLR, cytokine receptors)

    • Signaling differences between membrane-bound and soluble forms

  • Regulation of expression and localization:

    • Transcriptional and post-transcriptional regulation in different cell types

    • Trafficking mechanisms controlling cell surface localization

    • Potential regulation by microRNAs or epigenetic modifications

    • Stimulus-dependent redistribution within the plasma membrane

  • Additional binding partners:

    • Potential heterophilic binding partners beyond LPS

    • Interactions with extracellular matrix components

    • Binding to other cell adhesion molecules or receptors

    • The "unknown partners" that may interact with the Ninj1 26-37 motif in atherosclerosis

  • Structural dynamics:

    • Conformational changes upon homophilic binding

    • Membrane dynamics during oligomerization and PMR

    • Impact of lipid composition on Ninjurin-1 function

    • Structure-function relationships of different domains

  • Cell type-specific functions:

    • Ninjurin-1 functions in non-immune cells (e.g., epithelial cells, fibroblasts)

    • Tissue-specific roles beyond currently studied models

    • Developmental functions suggested by phenotypes in some knockout mice

    • Role in barrier function of specialized epithelia

  • Evolutionary aspects:

    • Conservation and divergence of Ninjurin-1 functions across species

    • Comparative analysis with Ninjurin-2 and other family members

    • Evolutionary drivers of Ninjurin-1's dual role in inflammation and PMR

  • Crosstalk with cell death pathways:

    • Precise triggering mechanisms for Ninjurin-1 oligomerization during cell death

    • Relationship between GSDMD pores and Ninjurin-1-mediated PMR

    • Potential regulatory mechanisms preventing premature PMR

These research directions would significantly advance our understanding of Ninjurin-1 biology and potentially reveal new therapeutic opportunities for inflammatory and degenerative diseases.

How might the field of Ninjurin-1 research evolve with emerging technologies?

Emerging technologies will likely transform our understanding of Ninjurin-1 biology in several key ways:

Advanced imaging technologies:

  • Super-resolution microscopy:

    • Visualizing Ninjurin-1 clustering and oligomerization at nanometer resolution

    • Tracking dynamics of membrane reorganization during PMR

    • Observing co-localization with binding partners in living cells

  • Cryo-electron tomography:

    • Examining Ninjurin-1 filament formation in near-native cellular environments

    • Visualizing membrane disruptions during PMR at molecular resolution

    • Building on existing cryo-EM structural data

  • Intravital imaging:

    • Monitoring Ninjurin-1-mediated cell-cell interactions in living organisms

    • Tracking leukocyte TEM in real-time during inflammation

    • Assessing effects of therapeutic interventions on cellular behavior

Single-cell technologies:

  • Single-cell transcriptomics:

    • Mapping Ninjurin-1 expression patterns across diverse cell populations

    • Identifying co-regulated genes and pathways

    • Tracking expression changes during disease progression

  • Single-cell proteomics:

    • Measuring Ninjurin-1 protein levels and modifications at single-cell resolution

    • Correlating with functional phenotypes

    • Identifying cell state-specific interaction partners

  • Spatial transcriptomics:

    • Mapping Ninjurin-1 expression within tissue microenvironments

    • Correlating with cellular infiltration and tissue damage

    • Understanding context-dependent regulation

Genetic engineering approaches:

  • CRISPR-based screening:

    • Identifying genes that modulate Ninjurin-1 expression or function

    • Discovering synthetic lethal interactions in Ninjurin-1-dependent cell death

    • Creating precise genetic models with domain-specific modifications

  • Cell type-specific conditional knockouts:

    • Dissecting tissue-specific functions of Ninjurin-1

    • Temporal control of Ninjurin-1 deletion to distinguish developmental vs. adult roles

    • Addressing contradictory findings in different disease models

  • Base editing and prime editing:

    • Introducing specific point mutations to dissect structure-function relationships

    • Creating humanized mouse models for translational studies

    • Engineering therapeutic cell populations

Computational approaches:

  • Molecular dynamics simulations:

    • Modeling Ninjurin-1 oligomerization and membrane interactions

    • Simulating conformational changes during activation

    • Virtual screening for small molecule modulators

  • AI-driven drug discovery:

    • Identifying novel inhibitors of Ninjurin-1-mediated PMR

    • Designing peptide mimetics with enhanced specificity and stability

    • Predicting off-target effects of Ninjurin-1-targeted therapeutics

  • Systems biology:

    • Integrating multi-omics data to build comprehensive models of Ninjurin-1 function

    • Identifying network-level effects of Ninjurin-1 modulation

    • Predicting disease-specific outcomes of therapeutic interventions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.