Recombinant Mouse NTPase KAP family P-loop domain-containing protein 1 (Nkpd1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Nkpd1; NTPase KAP family P-loop domain-containing protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-599
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Nkpd1
Target Protein Sequence
MQQEAAQRESEELQRVQWQPRRVRGWGVPKLLWFLVFLQPVITELHLRRRNVRFLFIRFS AWQYAGTDKLWAGLVTTLCEGIRHHYGALPFSVYSVLGNKPCGPRDGLCQREWHCRRRVC LALLALLAALCLGVGLLYLSLGGHAPGHGERGVLKALGGAATTLSGSGLLMAVYSVGKHL FVSQRKKIERLVSREKFGSQLGFMCEVKKEVELLTDFLCFLEIYQRRRLRVVLEVTGLDT CYPERVVGVLNAINTLLSDSHAPFIFILVVDPSILAACLESAGNMKGTADNGYLFLNRTV TLPFSVPIMGRRTKLQFLHDAVRSRDDLLFRELTIKLQPQSPGNLGAGEGTQLLAVETQG DAERTQGRVDAEAARRIQEALCCLHDEGDCLYEYVPDNVVSMRRIVNTVPITVRLLQQQQ QQQPDRVGPTPRHAVAWVVLANQWPCRLSWVLQCLEDRQQAGGAPEGRSRLWDVFCDNSR ELHTMTKALQNVLDLDGDPELFERFLGTDFPFTVAEAQSLLRCTVNLDHSIRRRMGLIRA VSALKPPSPPKSPSQDGPQASPRAIIAAGTSHAGQGSGHSKEAHQTRDRTHGGKPRPMA
Uniprot No.

Target Background

Gene References Into Functions
  1. Altered membrane NTPase activity is a biochemical hallmark of HPRT deficiency; however, species and cell-type variations must be considered. PMID: 15935074
Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Nkpd1 and what is its structural composition?

NTPase KAP family P-loop domain-containing protein 1 (Nkpd1) is a protein-coding gene found in mice that belongs to the KAP family of P-loop domain-containing proteins. The mouse Nkpd1 protein consists of 599 amino acids with several characteristic domains . Its full amino acid sequence starts with MQQEAAQRESEELQRVQWQPRR and contains multiple functional regions including transmembrane segments .

The protein's structural features include:

  • P-loop domain characteristic of NTPases

  • Predicted transmembrane segments

  • KAP family domain

For experimental use, recombinant Nkpd1 protein is typically prepared with a buffer containing 50% glycerol in Tris-based solution and may include purification tags that are determined during the production process .

What is known about Nkpd1 expression and localization in tissues?

Nkpd1 expression appears to be tissue-specific with varying expression levels across different organs and cell types. Based on current research:

  • In zebrafish, Nkpd1 is predicted to be located in cellular membranes

  • Expression has been noted in mouse nervous system tissues

  • The protein appears to have evolutionarily conserved expression patterns across species, with orthologs identified in humans and zebrafish

When designing experiments to examine Nkpd1 localization, researchers should consider using:

  • Immunohistochemistry with specific antibodies

  • Cell fractionation followed by Western blotting

  • Fluorescent tagging for live-cell imaging

Note that tissue-specific expression patterns may provide insights into its functional relevance in those particular tissues.

How should researchers store and handle recombinant Nkpd1 protein?

For optimal stability and activity of recombinant Nkpd1 protein, researchers should follow these evidence-based handling guidelines:

Storage ParameterRecommendationNotes
Short-term storage4°CUp to one week
Long-term storage-20°C or -80°CFor extended storage
Buffer compositionTris-based buffer with 50% glycerolOptimized for this protein
Freeze-thaw cyclesMinimizeRepeated freezing and thawing is not recommended
Working aliquotsStore at 4°CFor up to one week

For experimental use, reconstitute the lyophilized protein according to the manufacturer's instructions, typically at concentrations appropriate for your specific application .

What methodologies are most appropriate for investigating Nkpd1's role in neuropsychiatric disorders?

Nkpd1 has been implicated in depressive symptoms through genetic association studies. Researchers investigating its role in neuropsychiatric conditions should consider the following methodological approaches:

  • Genetic Association Analysis:

    • Gene-based association analysis of nonsynonymous variations, which previously revealed significant association between Nkpd1 and depressive symptoms (p = 3.7 × 10⁻⁸)

    • Population studies showing variants in Nkpd1 explaining approximately 0.9% of sex- and age-adjusted variance of depressive symptoms

  • Functional Studies:

    • Investigation of sphingolipid metabolism, as Nkpd1 is predicted to be involved in de novo synthesis of sphingolipids, which have been implicated in depression pathogenesis

    • Cell-based assays examining membrane dynamics and signaling pathways

  • Animal Models:

    • Development of Nkpd1 knockout or knockin mouse models expressing human variants

    • Behavioral testing focusing on depression-like phenotypes and cognitive assessment

  • Molecular Interaction Studies:

    • Identification of protein-protein interactions using techniques such as co-immunoprecipitation or yeast two-hybrid screening

    • Investigation of potential roles in signaling pathways relevant to neurological function

When designing these studies, researchers should account for sex differences in phenotypic expression, as noted in previous research .

How can researchers effectively study the association between Nkpd1 gene variants and cognitive impairment?

Recent evidence suggests potential associations between NKPD1 polymorphisms and amnestic mild cognitive impairment (aMCI) . For researchers investigating these connections:

  • Study Design Recommendations:

    • Utilize cohort designs with carefully characterized cognitive phenotypes

    • Include both aMCI and non-amnestic MCI (naMCI) groups for comparison

    • Consider gender as an important variable, as previous studies have shown gender differences in the association

  • Genotyping Strategies:

    • Focus on nonsynonymous variants that may affect protein function

    • Consider whole exome sequencing (WES) for comprehensive variant detection

    • Apply gene-based analysis approaches rather than single-SNP analyses

  • Functional Validation:

    • Investigate how identified variants affect protein function in cellular models

    • Examine potential effects on sphingolipid metabolism and related pathways

    • Correlate genetic findings with biomarkers of cognitive impairment

  • Data Analysis Approaches:

    • Apply appropriate statistical methods for genetic association testing, including correction for multiple testing

    • Consider gene-environment interactions that may influence the phenotypic expression

    • Use replication cohorts to validate initial findings, as demonstrated in the study of Nkpd1's association with depressive symptoms

What are the optimal experimental conditions for functional studies with recombinant Nkpd1 protein?

For researchers conducting functional studies with recombinant Nkpd1:

  • Protein Reconstitution:

    • Reconstitute lyophilized protein at concentrations appropriate for the specific assay

    • Use sterile conditions to prevent contamination

    • Consider the addition of protease inhibitors to prevent degradation

  • Activity Assays:

    • As a member of the NTPase family, consider designing assays to measure NTPase activity

    • Optimize buffer conditions based on predicted pH optimum and cation requirements

    • Include appropriate positive and negative controls

  • Interaction Studies:

    • When studying potential protein-protein interactions, consider using tag-free recombinant protein or account for potential tag interference

    • For membrane-associated studies, reconstitution in liposomes may be appropriate given the predicted membrane localization

  • Quality Control Measures:

    • Verify protein purity by SDS-PAGE

    • Confirm protein identity by mass spectrometry or Western blotting

    • Check for proper folding using circular dichroism or functional assays

How should researchers analyze the relationship between Nkpd1 and sphingolipid metabolism in the context of neurological disorders?

Given that Nkpd1 is predicted to be involved in de novo synthesis of sphingolipids , researchers investigating this relationship should consider:

  • Metabolomic Approaches:

    • Liquid chromatography-mass spectrometry (LC-MS) to profile sphingolipid species

    • Stable isotope labeling to track sphingolipid synthesis and turnover

    • Comparison of sphingolipid profiles in wild-type versus Nkpd1 variant/knockout models

  • Enzyme Activity Assays:

    • Development of specific assays to measure Nkpd1's enzymatic activity in sphingolipid synthesis

    • Determination of kinetic parameters with various substrates

    • Assessment of how disease-associated variants affect enzymatic function

  • Imaging Techniques:

    • Fluorescent sphingolipid analogs to track metabolism in live cells

    • Correlative light and electron microscopy to examine subcellular localization and trafficking

  • Integrative Analysis:

    • Correlation of sphingolipid metabolism with behavioral phenotypes in animal models

    • Systems biology approaches to understand the broader impact on lipid homeostasis

    • Integration with transcriptomic and proteomic data to identify regulatory networks

Researchers should note that disruptions in sphingolipid metabolism have been implicated in multiple neurological conditions, including depression , providing a mechanistic framework for understanding Nkpd1's role in these disorders.

What approaches are recommended for studying Nkpd1's genetic variation in different populations?

For researchers investigating population-specific genetic variations in Nkpd1:

  • Sequencing Strategies:

    • Targeted sequencing of Nkpd1 coding regions in different populations

    • Inclusion in exome sequencing panels to capture rare nonsynonymous variants

    • Consideration of regulatory regions that may affect expression levels

  • Population Genetics Analysis:

    • Calculation of allele frequencies and comparison across different populations

    • Identification of population-specific variants and potential functional impacts

    • Assessment of evidence for selection or demographic effects

  • Functional Classification of Variants:

    • Use of ACMG guidelines for variant classification

    • In silico prediction of variant effects using multiple algorithms

    • Experimental validation of potentially pathogenic variants

  • Statistical Considerations:

    • Power calculations based on variant frequency and expected effect size

    • Appropriate correction for population stratification

    • Meta-analysis approaches for combining data from multiple populations

This approach has proven effective in identifying significant associations, as demonstrated in studies that found Nkpd1 variants associated with depressive symptoms across multiple cohorts .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.