Recombinant Mouse Nuclear envelope phosphatase-regulatory subunit 1 (Cnep1r1)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse Nuclear Envelope Phosphatase-Regulatory Subunit 1 (Cnep1r1)

Recombinant Mouse Nuclear Envelope Phosphatase-Regulatory Subunit 1 (Cnep1r1) is a protein that plays a crucial role in regulating the activity of C-terminal Domain Nuclear Envelope Phosphatase 1 (CTDNEP1). CTDNEP1 is a non-canonical serine/threonine phosphatase involved in maintaining the morphology of the endoplasmic reticulum (ER) membrane. The regulatory subunit, Cnep1r1, enhances the phosphatase activity of CTDNEP1, which is essential for dephosphorylating proteins like lipin, thereby preventing ER expansion.

Function and Mechanism

Cnep1r1 acts as an activating regulatory subunit for CTDNEP1. It binds to CTDNEP1, stabilizing and enhancing its phosphatase activity. This interaction is crucial for maintaining ER membrane integrity and preventing its excessive expansion, which can lead to cellular dysfunction. The complex formed by Cnep1r1 and CTDNEP1 is evolutionarily conserved and plays a significant role in cellular processes related to ER biogenesis and maintenance.

Research Findings

Recent studies have highlighted the importance of the CTDNEP1-Cnep1r1 complex in human cells. Knockdown experiments have shown that depleting either CTDNEP1 or Cnep1r1 results in identical phenotypes, emphasizing their interdependence in regulating ER morphology. High-resolution crystal structures of the complex have revealed how Cnep1r1 allosterically activates CTDNEP1 by binding at a site distant from the active site, facilitating substrate recognition and dephosphorylation .

Clinical Implications

Mutations in CTDNEP1 have been associated with medulloblastoma, an aggressive childhood cancer. The role of Cnep1r1 in stabilizing and activating CTDNEP1 suggests that disruptions in this regulatory mechanism could contribute to disease progression. Understanding the molecular details of the CTDNEP1-Cnep1r1 interaction is crucial for developing therapeutic strategies targeting ER-related pathologies.

Data Tables

While specific data tables for recombinant mouse Cnep1r1 are not readily available, studies on the human homolog provide valuable insights into its function and mechanism. For instance, biochemical assays have demonstrated that Cnep1r1 enhances the catalytic activity of CTDNEP1 towards substrates like lipin .

ProteinFunctionInteraction with CTDNEP1
Cnep1r1Regulatory subunitEnhances phosphatase activity, stabilizes CTDNEP1
CTDNEP1Non-canonical serine/threonine phosphataseDephosphorylates lipin, maintains ER morphology

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our default shipping includes standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for your use.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Cnep1r1; Tmem188; Nuclear envelope phosphatase-regulatory subunit 1; NEP1-R1; Transmembrane protein 188
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-125
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Cnep1r1
Target Protein Sequence
MNSLEQAEDLKAFERRLTEYIHCLQPATGRWRMLLIVVSVCTATGAWNWLIDPETQKVSF FTSLWNHPFFTISCITLIGLFFAGIHKRVVAPSIIAARCRTVLAEYNMSCDDTGKLILKP RPHVQ
Uniprot No.

Target Background

Function

CNEP1 forms an active complex with the serine/threonine protein phosphatase, participating in the dephosphorylation and potential activation of LPIN1 and LPIN2. These phosphatidate phosphatases catalyze the conversion of phosphatidic acid to diacylglycerol, regulating fatty acid metabolism at various levels. CNEP1 may indirectly modulate the lipid composition of nuclear and/or endoplasmic reticulum membranes and be essential for proper nuclear membrane morphology and/or dynamics. It may also indirectly regulate lipid droplet production and triacylglycerol levels.

Gene References Into Functions
  1. Nuclear envelope phosphatase 1-regulatory subunit 1 (formerly TMEM188), the metazoan Spo7p ortholog, functions within the lipin activation pathway. PMID: 22134922
Database Links
Protein Families
CNEP1R1 family
Subcellular Location
Nucleus membrane; Multi-pass membrane protein. Cytoplasm.
Tissue Specificity
Muscle specific with lower expression in other metabolic tissues.

Q&A

What is Cnep1r1 and what is its primary function?

Cnep1r1 (CTD nuclear envelope phosphatase 1 regulatory subunit 1) is a protein-coding gene that plays a critical role in regulating nuclear envelope phosphatase activity. It functions as a regulatory subunit that modulates the activity of CTD nuclear envelope phosphatase 1, which is involved in multiple cellular processes including nuclear envelope assembly, cell division, and DNA damage response pathways . The protein exists in multiple isoforms, including nuclear envelope phosphatase-regulatory subunit 1 isoform X1 and X2, with potential functional differences that remain under investigation .

What expression vectors are recommended for mouse Cnep1r1 cloning?

For recombinant expression of mouse Cnep1r1, the pcDNA3.1+/C-(K)DYK vector system has been validated and is widely used in research settings. This vector incorporates a C-terminal DYKDDDDK tag that facilitates protein detection and purification . Alternative expression vectors can be employed based on specific experimental requirements, but a vector supporting mammalian expression with appropriate selection markers is essential for most applications. The insertion of Cnep1r1 into expression vectors is typically achieved using CloneEZ™ Seamless cloning technology or similar methods that preserve the integrity of the coding sequence .

How do I validate the expression of recombinant Cnep1r1 after transfection?

Validation of recombinant Cnep1r1 expression requires a multi-step approach:

  • Western blot analysis using antibodies against the protein or the vector-encoded tag (e.g., DYKDDDDK tag)

  • RT-qPCR to confirm mRNA expression levels

  • Immunofluorescence microscopy to verify subcellular localization at the nuclear envelope

  • Functional assays to assess phosphatase regulatory activity
    When using tagged constructs, always confirm that the tag does not interfere with normal protein localization or function by comparing with untagged controls or native protein behavior.

What are the optimal CRISPR-Cas9 strategies for Cnep1r1 knockout studies?

For effective CRISPR-Cas9 targeting of mouse Cnep1r1, multiple gRNA constructs should be employed simultaneously to increase knockout efficiency. The gRNA sequences designed by the Feng Zhang laboratory at the Broad Institute have demonstrated high specificity for the Cnep1r1 gene with minimal off-target effects . When designing knockout experiments:

  • Select at least two gRNA constructs targeting different exons of Cnep1r1

  • Verify gRNA sequences against your specific mouse strain genome to ensure target specificity

  • Validate knockout efficiency using both protein and mRNA detection methods

  • Screen multiple clones to identify complete knockout populations
    For partial knockdown rather than complete knockout, consider using inducible CRISPR systems or carefully titrated transfection of gRNA constructs to achieve modulated expression levels .

How can the single mouse experimental design be applied to studies involving Cnep1r1 manipulation?

The single mouse experimental design offers advantages for studies involving Cnep1r1 genetic manipulation, particularly when assessing phenotypic outcomes across diverse genetic backgrounds. This approach involves:

  • Using individual mice with different genetic backgrounds or modifications

  • Employing robust endpoints such as event-free survival (EFS) and percent regression

  • Conducting extended observation periods (up to 20 weeks) to capture long-term effects

  • Integrating genomic and transcriptomic analyses to identify correlations between genetic context and observed phenotypes
    This approach allows researchers to encompass greater genetic diversity while reducing animal usage, which is particularly valuable when studying the effects of Cnep1r1 modification in the context of different cancer models or developmental systems .

What are the key considerations for designing mutation studies in the Cnep1r1 gene?

When designing mutation studies for Cnep1r1:

  • Prioritize functional domains for targeted mutagenesis

  • Consider the influence of mutations on protein-protein interactions, particularly with phosphatase partners

  • Use computational prediction tools to assess potential impacts of mutations before experimental validation

  • Design experiments that can distinguish between mutations affecting protein stability versus those affecting regulatory function
    Mutations in genes involved in DNA damage response pathways (such as TP53 and 53BP1) have been observed to influence cellular sensitivity to certain drugs and treatments . When studying Cnep1r1 mutations, consider potential interactions with these pathways and design appropriate controls to isolate specific effects.

What techniques are most effective for assessing Cnep1r1's role in nuclear envelope dynamics?

To investigate Cnep1r1's role in nuclear envelope dynamics:

  • Live-cell imaging with fluorescently tagged Cnep1r1 and nuclear envelope markers

  • Electron microscopy to visualize ultrastructural changes in nuclear envelope morphology

  • FRAP (Fluorescence Recovery After Photobleaching) to measure protein mobility at the nuclear envelope

  • Proximity ligation assays to identify interaction partners at the nuclear envelope
    These approaches should be complemented with genetic manipulation (knockdown/knockout/overexpression) to establish causal relationships between Cnep1r1 levels and observed nuclear envelope phenotypes.

How should RNA sequencing data be analyzed to identify Cnep1r1-dependent gene expression changes?

For robust analysis of RNA sequencing data in Cnep1r1 studies:

  • Computationally remove mouse reads when working with xenograft models

  • Apply appropriate normalization methods (such as FPKM or TPM) for gene expression quantification

  • Conduct Gene Set Enrichment Analysis (GSEA) to identify pathways affected by Cnep1r1 manipulation

  • Compare expression profiles between Cnep1r1 wild-type and mutant/knockout samples with attention to DNA damage response genes
    When analyzing differential gene expression, prioritize multi-sample comparisons over pairwise analyses to increase statistical power and account for biological variability. Pay particular attention to genes involved in nuclear envelope function, cell cycle regulation, and DNA damage response pathways.

What are common pitfalls in interpreting phenotypes of Cnep1r1 knockout models?

When interpreting phenotypes in Cnep1r1 knockout models, researchers should be aware of:

  • Potential compensatory mechanisms by related phosphatase regulatory proteins

  • Context-dependent effects that vary across different tissues or cell types

  • Distinguishing between direct effects of Cnep1r1 loss versus secondary consequences

  • Variability in phenotype severity that may correlate with genetic background
    A comprehensive phenotypic analysis should include both cellular and physiological parameters, with careful control for genetic background effects that might confound interpretation . When possible, employ conditional knockout systems to avoid developmental compensation mechanisms.

How can researchers address the challenge of Cnep1r1 antibody specificity?

Addressing antibody specificity challenges for Cnep1r1 detection:

  • Validate antibodies using positive controls (overexpression systems) and negative controls (knockout tissues/cells)

  • Employ epitope-tagged recombinant Cnep1r1 in parallel with antibody-based detection of endogenous protein

  • Use multiple antibodies targeting different epitopes of the protein

  • Complement antibody-based detection with mRNA quantification
    For difficult-to-detect isoforms, consider creating isoform-specific tagged constructs for expression studies or designing isoform-specific CRISPR targeting strategies for selective manipulation.

What statistical approaches are recommended for analyzing complex phenotypes in Cnep1r1 studies?

For complex phenotypic analyses in Cnep1r1 research:

  • Apply event-free survival (EFS) analyses for long-term phenotypic studies

  • Use Fisher's exact test for categorical comparisons, such as mutation status correlations

  • Implement multiple testing adjustment with false discovery rate control for genome-wide analyses

  • Consider regression models that can account for multiple variables when assessing phenotype-genotype correlations
    When dealing with genomic data, employ established bioinformatics pipelines for copy number variation detection, mutation calling, and gene expression quantification. For models with varying genetic backgrounds, stratify analyses accordingly to identify background-specific effects.

How does Cnep1r1 interact with DNA damage response pathways?

The interaction between Cnep1r1 and DNA damage response pathways involves complex regulatory mechanisms:

  • Mutations in DNA damage response genes (such as 53BP1) have been observed to correlate with cellular sensitivity phenotypes in experimental models

  • Wild-type TP53 status, or specific mutations in TP53 combined with mutations in 53BP1, indicate defects in DNA damage response that may interact with Cnep1r1 function

  • Phosphorylation-dependent signaling at the nuclear envelope, potentially regulated by Cnep1r1, plays a role in DNA damage sensing and repair processes
    Research approaches should include co-immunoprecipitation studies, proximity ligation assays, and genetic interaction screens to fully characterize the functional relationships between Cnep1r1 and DNA damage response proteins.

What is the relationship between Cnep1r1 expression and drug sensitivity in cancer models?

The relationship between Cnep1r1 expression and drug sensitivity requires careful experimental design:

  • Employ the single mouse experimental design to assess drug responses across multiple genetic backgrounds

  • Measure both initial tumor volume regression and event-free survival as complementary endpoints

  • Correlate Cnep1r1 expression levels with sensitivity to specific chemotherapeutic agents or targeted therapies

  • Analyze potential biomarkers that could predict response, such as mutations in DNA damage response genes
    Studies have shown that sensitivity to certain drugs correlates with specific genetic mutations, suggesting that Cnep1r1 expression patterns might similarly serve as predictive biomarkers for treatment response. Analysis of drug transport genes such as ABCB1 and ABCG2 should be included to account for potential confounding effects on drug sensitivity .

What emerging technologies show promise for advanced Cnep1r1 functional studies?

Emerging technologies with potential for Cnep1r1 research include:

  • Cryo-electron tomography for high-resolution structural analysis of Cnep1r1 in its native nuclear envelope context

  • CRISPR-based epigenome editing to study regulatory mechanisms controlling Cnep1r1 expression

  • Single-cell multi-omics approaches to characterize cell-type-specific functions and variability

  • Protein-protein interaction screens using BioID or APEX proximity labeling to identify the Cnep1r1 interactome
    These technologies would complement traditional approaches by providing more detailed molecular insights into Cnep1r1 function at the single-cell and subcellular levels.

How might Cnep1r1 research inform therapeutic strategies for diseases involving nuclear envelope dysfunction?

Translational applications of Cnep1r1 research could include:

  • Development of targeted therapies for diseases characterized by nuclear envelope abnormalities

  • Identification of biomarkers for predicting treatment response based on Cnep1r1 expression or mutation status

  • Design of synthetic biology approaches to modulate nuclear envelope phosphatase activity in disease contexts

  • Exploration of combination therapies targeting both Cnep1r1 and interacting pathways Research should focus on establishing causative links between Cnep1r1 dysfunction and disease phenotypes before advancing to therapeutic development, with careful validation across multiple model systems.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.