Recombinant Mouse Nucleolar complex protein 4 homolog (Noc4l)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates. Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, provided as a guideline for customers.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process. The specific tag type is determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
Noc4l; Nucleolar complex protein 4 homolog; NOC4 protein homolog; NOC4-like protein; Nucleolar complex-associated protein 4-like protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-516
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Noc4l
Target Protein Sequence
MERHPASASSRQELGRLLEAVLTSRGQANAVFDILAVLQSEEPEEIEEGVRTCSRLFGTL LEREELFVGSLPSEDTALAGSQGATYKYKVWIRHRYHSCCNRLEELLAHPTFQVKELALK TLMKFVQLEGAKPLEKPQWESHYLFPRTLFRAVVGGLLTPEDDHSLLISHFCEYLEYDDI RYHTMQVATSIMARATSQQPEVSLTLWNNAFTLLSAVSLPLQECELTNFYVKHAQTSDKW KVVHLKEHKKAFQEMWLGFLKHKLPLSLYKKVLVAMHDSILPHLAQPTLMIDFLTSACDV GGAISLLALNGLFILIHKHNLEYPDFYQKLYGLLDPSIFHVKYRARFFHLADLFLSSSHL PAYLVAAFAKRLARLALTAPPEALLMVLPLICNLLRRHPACRVMVHRPQGPELDADPYDP TEKDPARSRALESCLWELQTLQQHYHPEVSKAASVINQVLSVPEVSIAPLLELTAYEIFE QDLKKKMPESVPLEFIPAKGLLGRQDDLCTQFFCLS
Uniprot No.

Target Background

Database Links
Protein Families
CBF/MAK21 family
Subcellular Location
Nucleus membrane; Multi-pass membrane protein. Nucleus, nucleolus.

Q&A

What is Nucleolar Complex Protein 4 Homolog (Noc4l) and what are its primary functions?

Nucleolar complex associated 4 homolog (NOC4L), also known as NOC4, is a homolog of yeast Noc4p. In yeast, Noc4p forms a complex with Nop14p and is primarily involved in the assembling and transporting of ribosome 40S subunit . In mammals, while this protein was initially characterized for its role in ribosome biogenesis, recent research has uncovered unexpected functions in inflammation and metabolic regulation.

NOC4L plays critical roles in multiple biological processes, including:

  • Ribosome biogenesis and protein translation regulation

  • Inhibition of TLR4 internalization and the TLR4/TRIF pathway in macrophages

  • Regulation of inflammatory responses in the context of obesity

  • Modulation of T cell activation and proliferation

Deletion of Noc4l has been shown to lead to embryonic lethality in mice, underscoring its essential role in development .

What is the expression pattern of Noc4l in mouse tissues?

Noc4l displays a tissue-specific expression pattern in mice. It is preferentially expressed in:

  • Testis (highest expression)

  • Lung

  • White adipose tissue (WAT)

  • Immune organs

Within these tissues, Noc4l shows cell-type specific expression. For instance, in adipose tissue, Noc4l is predominantly expressed in adipose tissue macrophages (ATMs), as demonstrated by co-localization with macrophage markers F4/80 and Mac-2 in immunofluorescence analyses . It is also highly expressed in bone marrow-derived cells, particularly in activated T cells .

How is Noc4l expression regulated in disease states?

Noc4l expression is dynamically regulated during pathological conditions, particularly in obesity and inflammation:

  • NOC4L expression is significantly decreased in white adipose tissue of diet-induced obese (DIO) mice and genetically diabetic mice (db/db)

  • Similar reduction in NOC4L expression is observed in adipose tissue of obese humans

  • In macrophages, Noc4l expression is downregulated by lipopolysaccharide (LPS) treatment in a time-dependent manner

  • Palmitic acid (PA) treatment also reduces Noc4l expression in macrophages in a dose-dependent manner

These findings suggest that Noc4l expression is sensitive to inflammatory and metabolic stressors associated with obesity and insulin resistance.

What mouse models are available for studying Noc4l function?

Several mouse models have been developed to study Noc4l function:

  • Global Noc4l knockout mice: Complete deletion of Noc4l leads to embryonic lethality, highlighting its essential role in development .

  • Myeloid-specific Noc4l knockout mice (Noc4l LKO): Generated using the Cre-loxP system with LysM-Cre to delete Noc4l specifically in myeloid cells. These mice show:

    • Increased susceptibility to high-fat diet (HFD)-induced insulin resistance

    • Enhanced inflammatory responses

    • Impaired glucose tolerance

    • Altered macrophage polarization

  • Noc4l overexpression models:

    • Lentivirus-mediated Noc4l overexpression (Lv-Noc4l): Achieved through tail intravenous injection of Lv-Noc4l in mice

    • Transgenic mice with Noc4l overexpression

  • Noc4l mCherry reporter mice: Transgenic reporter mice expressing Noc4l-mCherry fusion protein, useful for tracking Noc4l expression in different cell populations and under various conditions .

What techniques are recommended for detecting Noc4l expression?

Several techniques have been used successfully to detect Noc4l expression:

  • Quantitative RT-PCR (qRT-PCR): For measuring Noc4l mRNA expression in tissues and cells. This has been used to detect changes in Noc4l expression in response to LPS and PA treatment in macrophages .

  • Western blotting: Using specific antibodies against NOC4L. Two antibodies have been described:

    • Mouse monoclonal antibody (3L7)

    • Rabbit polyclonal antibody (6R)
      Both have been validated for specificity using NOC4L-Flag vector overexpression and Noc4l-ablated bone-marrow-derived macrophages (BMDMs) .

  • Immunofluorescence: Double immunofluorescence analyses using NOC4L antibodies together with macrophage markers (F4/80 or Mac-2) have been used to demonstrate co-localization in adipose tissue macrophages .

  • Flow cytometry: Particularly useful with reporter mice expressing Noc4l-mCherry to determine expression levels in specific cell populations, such as CD4+ T cells under different activation conditions .

How can researchers isolate and culture cells for Noc4l functional studies?

For studying Noc4l function in macrophages:

  • Bone marrow-derived macrophages (BMDMs):

    • Isolate bone marrow cells from femurs and tibias of mice

    • Culture in DMEM supplemented with M-CSF for 7 days

    • BMDMs can be treated with LPS to promote M1 polarization or IL-4 to promote M2 polarization

    • Expression of M1 markers (IL-6, TNFα, MCP1) and M2 markers (Arg1, Mrc1) can be assessed by qRT-PCR

  • Adipose tissue macrophages (ATMs):

    • Isolate from white adipose tissue through enzymatic digestion and centrifugation

    • Separate macrophages from other stromal vascular cells using flow cytometry or magnetic bead separation

For T cell studies:

  • Isolate CD4+ T cells from spleen and lymph nodes

  • Culture under different polarization conditions (Th1, Th17)

  • Monitor Noc4l expression along with cell proliferation markers

How does Noc4l regulate inflammatory pathways in macrophages?

Noc4l plays a crucial role in regulating inflammatory signaling in macrophages through interaction with Toll-like receptor 4 (TLR4):

  • Inhibition of TLR4 endocytosis: Noc4l interacts with TLR4 to inhibit its endocytosis, which prevents activation of the TRIF-dependent pathway that occurs in endosomes .

  • Suppression of the TLR4/TRIF pathway: By blocking the endosomal TLR4/TRIF pathway, Noc4l ameliorates inflammatory signaling that contributes to low-grade systemic inflammation (LSI) and insulin resistance (IR) .

  • Regulation of macrophage polarization: Noc4l deficiency promotes M1-like (pro-inflammatory) macrophage polarization:

    • Noc4l-knockout macrophages show increased expression of M1 markers (IL-6, TNFα, MCP1) in response to LPS stimulation

    • Reduced expression of M2 (anti-inflammatory) markers like Arg1 and Mrc1

    • Decreased production of anti-inflammatory cytokine IL-10

These mechanisms collectively explain how Noc4l deficiency exacerbates inflammatory responses in macrophages, contributing to metabolic abnormalities in conditions like obesity.

What is the role of Noc4l in metabolic regulation?

Noc4l plays a significant role in metabolic regulation, particularly in the context of obesity and insulin resistance:

  • Glucose homeostasis: Macrophage-specific deletion of Noc4l (Noc4l LKO) leads to:

    • Increased fasting blood glucose

    • Impaired glucose tolerance

    • Reduced insulin sensitivity, especially when challenged with high-fat diet (HFD)

  • Insulin signaling: Noc4l LKO mice show:

    • Attenuated insulin-stimulated AKT (Ser473) phosphorylation in white adipose tissue and muscle

    • This indicates impaired insulin signaling in these tissues

  • Lipid metabolism: Noc4l LKO mice exhibit:

    • Increased serum concentrations of free fatty acids (FFAs)

    • Elevated triglycerides (TGs)

    • Higher cholesterol levels

  • Adipose tissue function: Noc4l overexpression via lentivirus treatment:

    • Reduces total fat weight, including epididymal, inguinal, and perinephric fat

    • Ameliorates symptoms of fatty liver disease

These findings suggest that Noc4l in macrophages serves as a protective factor against metabolic dysregulation, particularly in the context of diet-induced obesity.

How does Noc4l function in T cell activation and proliferation?

In T cells, Noc4l appears to play important roles in activation and proliferation:

  • Expression pattern in T cells: Noc4l expression increases in activated CD4+ T cells compared to resting cells .

  • Association with proliferation: The expression of Noc4l is closely associated with the proliferation and division of activated T cells:

    • Higher expression is observed in rapidly proliferating T cells

    • Noc4l likely contributes to the increased protein synthesis needed during T cell activation and proliferation

  • Protein interactions: In vitro experiments have revealed that Noc4l interacts with proteins involved in:

    • Ribosome assembly

    • Cell proliferation during T cell activation

    • These interactions suggest a role in post-transcriptional regulation in helper T cells

  • T cell differentiation: Noc4l may have differential roles in various T helper cell subsets, including Th1 and Th17 cells, though the specific mechanisms require further investigation .

How can Noc4l be targeted therapeutically in metabolic disorders?

Based on the protective role of Noc4l against insulin resistance and inflammation, several therapeutic approaches could be considered:

  • Lentiviral-mediated Noc4l overexpression: Experimental evidence shows that Lv-Noc4l administration in diet-induced obese mice:

    • Decreases glucose intolerance

    • Improves insulin resistance

    • Reduces total fat weight

    • Alleviates fatty liver disease

This suggests that enhancing Noc4l expression or activity could potentially mitigate metabolic dysfunction associated with obesity.

  • Targeting regulators of Noc4l expression: Understanding the mechanisms that lead to decreased Noc4l expression in obesity might reveal upstream targets for intervention. Both LPS and palmitic acid downregulate Noc4l expression in macrophages, suggesting that targeting these pathways might help maintain Noc4l levels .

  • Targeting the TLR4/TRIF pathway: Since Noc4l functions by inhibiting TLR4 internalization and the subsequent activation of the TRIF pathway, alternative approaches to block this pathway might recapitulate the beneficial effects of Noc4l overexpression .

What strategies can be used to study Noc4l protein interactions?

Several approaches can be employed to investigate Noc4l protein interactions:

  • Co-immunoprecipitation (Co-IP): Can be used to identify proteins that physically interact with Noc4l. This approach has revealed interaction between Noc4l and TLR4 .

  • Proximity labeling methods: Techniques like BioID or APEX2 could be used to identify proteins in close proximity to Noc4l within living cells.

  • Immunofluorescence co-localization: Double immunofluorescence analyses have been used to show co-localization of NOC4L with macrophage markers (F4/80 or Mac-2) in adipose tissue .

  • In vitro binding assays: Using recombinant proteins to assess direct interactions between Noc4l and candidate partners like TLR4.

  • Mass spectrometry-based approaches: To identify novel interacting partners during T cell activation, as mentioned in the research on Th1 and Th17 cells .

How should researchers interpret the dual role of Noc4l in ribosome biogenesis and immune regulation?

The dual function of Noc4l in ribosome biogenesis and immune regulation raises interesting questions about its physiological role:

  • Evolutionary perspective: Noc4l's ancestral function appears to be in ribosome biogenesis (as in yeast), but it has evolved additional functions in mammals, particularly in immune cells .

  • Cell-type specific functions: Researchers should consider that Noc4l may have different primary functions depending on the cell type:

    • In macrophages, its interaction with TLR4 and regulation of inflammatory pathways appears prominent

    • In T cells, its role in ribosome assembly and protein synthesis during activation may be more significant

  • Linking ribosome function to inflammation: Consider how these functions might be interconnected:

    • Altered ribosome biogenesis could affect translation of specific mRNAs important for immune responses

    • Changes in protein synthesis capacity could influence cell fate decisions in immune cells

    • Stress responses that affect ribosome biogenesis might be linked to inflammatory pathway activation

  • Context-dependent regulation: The regulation of Noc4l expression by inflammatory stimuli like LPS suggests its functions may be dynamically modulated during immune responses .

What controls should be included when studying recombinant Noc4l?

When working with recombinant Noc4l, appropriate controls are essential:

  • Antibody specificity controls:

    • Use Noc4l-Flag vector to overexpress NOC4L and detect expression as a positive control

    • Include Noc4l-ablated cells (like BMDMs from Noc4l LKO mice) as negative controls

    • These approaches have been validated for confirming the specificity of NOC4L antibodies

  • Expression system controls:

    • When overexpressing Noc4l via lentivirus (Lv-Noc4l), verify increased expression in target tissues (e.g., liver and WAT) by qRT-PCR or Western blot

    • Include empty vector controls

  • Functional assay controls:

    • When assessing the effect of Noc4l on TLR4 signaling, verify that expression levels of TLR4 and its regulator CD14 are not altered by Noc4l manipulation

    • This has been confirmed in BMDMs from Noc4l fl/fl, Noc4l LKO, and OE mice

  • Weight-matched controls: To distinguish metabolic effects of Noc4l from those due to differences in body weight, include weight-matched control groups, as done for insulin tolerance tests comparing Noc4l LKO and Noc4l fl/fl mice on HFD .

How can researchers address variability in Noc4l expression analysis?

Researchers may encounter variability when analyzing Noc4l expression. Here are strategies to address this:

  • Multiple detection methods: Use complementary techniques (qRT-PCR, Western blot, immunofluorescence) to confirm expression patterns .

  • Time-course analysis: Noc4l expression changes in a time-dependent manner in response to stimuli like LPS, so including multiple time points is crucial .

  • Dose-response relationships: Similarly, Noc4l regulation by factors like palmitic acid occurs in a dose-dependent manner, requiring careful titration .

  • Cell-type specific analysis: Given Noc4l's differential expression across cell types, isolate specific cell populations (e.g., macrophages from adipose tissue) when possible, rather than analyzing whole tissues .

  • Reporter systems: For in vivo tracking, consider reporter systems like the Noc4l-mCherry mice, which allow for flow cytometric quantification of Noc4l expression in specific cell populations .

What are emerging areas of Noc4l research beyond metabolism and inflammation?

While current research has focused on Noc4l's roles in metabolism, inflammation, and T cell activation, several emerging areas warrant investigation:

  • Cancer biology: The mention of ADAP1-NOC4L in oncogenic fusion transcript analysis suggests potential roles in cancer that remain to be fully explored.

  • Developmental biology: Given that global deletion of Noc4l leads to embryonic lethality , its developmental functions deserve further study.

  • Stress responses: The regulation of Noc4l by stressors like LPS suggests it may participate in cellular stress response pathways beyond inflammation.

  • Tissue-specific functions: While current research has focused on immune cells and adipose tissue, Noc4l's high expression in testis suggests unexplored functions in reproductive biology.

  • Interactions with other signaling pathways: Beyond TLR4/TRIF signaling, Noc4l might interact with other important cellular signaling networks.

How might single-cell technologies advance our understanding of Noc4l biology?

Single-cell technologies could provide valuable insights into Noc4l biology:

  • Single-cell RNA sequencing (scRNA-seq): Could reveal:

    • Cell-type specific expression patterns of Noc4l

    • Heterogeneity in Noc4l expression within macrophage or T cell populations

    • Correlation of Noc4l expression with specific cellular states or activation stages

  • Single-cell proteomics: May identify:

    • Post-translational modifications of Noc4l in different cell types

    • Cell-specific protein interaction networks

  • Spatial transcriptomics: Could map:

    • Noc4l expression patterns within tissues with spatial context

    • Relationship between Noc4l-expressing cells and their microenvironment

These approaches might help resolve conflicting data and provide a more nuanced understanding of Noc4l's diverse functions in different cellular contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.