Recombinant Mouse Nucleoporin NDC1 (Tmem48)

Shipped with Ice Packs
In Stock

Description

Oncological Relevance of NDC1 Overexpression

NDC1 overexpression is implicated in multiple cancers, acting as an oncogene by promoting proliferation, migration, and chemoresistance.

Key Cancer Associations

Cancer TypeNDC1 Overexpression EffectsMechanistic LinksSource
NSCLC↑ Cell cycle progression (G2/M phase), ↓ Apoptosis (Bax↑, Bcl-2↓)Cyclin B1/CDK1/CDC6 downregulation
Cervical CancerWnt/β-catenin activation (TCF1/AXIN2↑), metastasisLiCl rescues proliferation post-NDC1 knockdown
Pancreatic CancerPrognostic marker; correlates with immune infiltration (M1 macrophages)TME modulation via antigen-processing machinery

Experimental Evidence

  • Knockdown Studies:

    • NSCLC (A549/H1299): Reduced proliferation, G0/G1 arrest, and apoptosis induction .

    • Cervical Cancer (SiHa/HeLa): β-catenin/TCF1 suppression, tumor growth inhibition in xenografts .

  • Pan-Cancer Analysis: High NDC1 expression correlates with poor progression-free survival in 14 cancers, including pancreatic, lung, and cervical .

Recombinant NDC1 in Research: Applications and Challenges

Recombinant NDC1 proteins are primarily used to study NPC dynamics and cancer mechanisms. While mouse-specific recombinant products are not explicitly documented, insights from human/rat homologs highlight potential applications:

Recombinant Protein Characteristics

AttributeDetailSource
Expression SystemsMammalian cells (e.g., HEK293)
Purity>85% (SDS-PAGE)
TagsmNeonGreen/mRuby for live imaging (C. elegans studies)
Antibody BlockingControl fragments (e.g., aa 134–165) used in IHC/WB validation

Experimental Use Cases

  • NPC Assembly Studies: Depletion of NDC1 in C. elegans embryos reduces NPC density and nuclear import rates .

  • Cancer Therapeutics: Silencing NDC1 sensitizes NSCLC to cisplatin and reduces TGF-β/ERK signaling in triple-negative breast cancer .

Table 1: NDC1-Associated Tumor-Regulatory Pathways

PathwayNDC1’s RoleCancer TypeSource
Cell Cycle↑ Cyclin B1/CDK1/CDC6; ↓ G0/G1 phaseNSCLC, Cervical
Wnt/β-cateninActivates β-catenin/TCF1/AXIN2; promotes metastasisCervical, Colorectal
Apoptosis↓ Bax, ↑ Bcl-2/XIAP/survivinNSCLC, Pancreatic

Table 2: NDC1’s Prognostic Value Across Cancers

Cancer TypeHigh NDC1 Expression Correlates WithSurvival OutcomeSource
NSCLCAdvanced stage, lymph node metastasis, larger tumorsShorter survival
PancreaticImmune cell infiltration (M1 macrophages, Treg cells)Poor PFS

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us; we will prioritize development of the specified tag.
Synonyms
Ndc1; Tmem48; Nucleoporin NDC1; Transmembrane protein 48
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-673
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Ndc1
Target Protein Sequence
MATAASGPCAGGSPRDILWRVLGWRIVTSIVWSVVLLPVCITAFIVLSSINLFHPIQWLS DSCNDFYSSQVIFHLLLLAVVIIIISIFNVEFYTVVPSISGSRLALIARILHPQQLTHSF IHAAMGMAVAWCAAIMTKGQYSSLVVPCTGTESLDSPAAQTCLNEYHLFFLLSGAFMGYS YSLLYFINNMNYLPFPIIQQYKFLRFRRSLLLLVKHSCVESLFMVRNFCIVYYFFGHIPK AWISTALDLHTDEQAHRPLDTIGGLLNVSLLYHVWLCGVFLLVTWYSSWILFKIYATEAH VFPVQPPFAEASDECLPKVLNSNPPRIVKYLALQDLMLLSQYSPSRRQEVFSLSQPGGHP HNWTAISRECLNLLNDMTQKLVLYQEAAATNGRMYSSYSVEPKKLSSAEETAFQTPKPSQ TPSVPPLVKTSLFSPKLSTPNVSSPFGTPFGSSVVNRMAGILDVNPFSGSPQSPQLIRRG PRLWTHTSDQQVSAISNPSPCASVTAEGKTVRQPSVIYSWIQNKREQIKNFLSKRVLIMY FFSKHPEASIQAVFSDAQMHIWALEGLSHLVAASFTEDRFGVVQTTLPAILHTLLTLQEA VDKYFKLPHASSKPPRASGSLVDTSYKTLRFAFRASLKTAIYRITTTFGEHLNAVQASAE HQKRLQQFLEFKE
Uniprot No.

Target Background

Function
Nucleoporin NDC1 (Tmem48) is a component of the nuclear pore complex (NPC), playing a crucial role in de novo NPC assembly and insertion into the nuclear envelope. It is essential for NPC and nuclear envelope formation, likely by linking the nuclear envelope membrane to soluble nucleoporins, thereby anchoring the NPC within the membrane.
Gene References Into Functions
  1. A mutation in the Tmem48 gene (encoding Nucleoporin NDC1) causes gametogenesis defects and sterility in sks mice. PMID: 24045954
Database Links
Protein Families
NDC1 family
Subcellular Location
Nucleus, nuclear pore complex. Nucleus membrane; Multi-pass membrane protein.

Q&A

What is Nucleoporin NDC1 (Tmem48) and what is its primary role in cellular function?

NDC1 (Nuclear Division Cycle 1), also known as TMEM48 (Transmembrane Protein 48), is a transmembrane nucleoporin containing 656 amino acids arranged in 6-7 transmembrane domains that localizes to nuclear pore complexes (NPCs) . It functions as a dynamic membrane adaptor that helps recruit and promote the self-assembly of the nuclear pore scaffold to drive post-mitotic NPC assembly . NDC1 participates in cell mitosis by serving as a component of both the nuclear pore complex and the spindle, and has been demonstrated to control nuclear pore complex density and nuclear size in yeast and early C. elegans embryo .

Methodological approach: To study NDC1's primary functions, researchers typically employ CRISPR-Cas9 gene editing to delete the ndc1 gene locus (as demonstrated in C. elegans) followed by differential interference contrast (DIC) microscopy to observe resulting nuclear phenotypes such as reduced pronuclear size .

How does the structure of mouse NDC1 protein relate to its function?

Mouse NDC1 (Tmem48) is a putative transmembrane protein with six transmembrane domains that comprises part of the nuclear pore complex . The gene encoding NDC1 in mice is called Tmem48, and its proper splicing is critical for function. When mutations occur that affect splicing, such as those deleting exon 6 of the Tmem48 transcript, the resulting protein demonstrates functional defects .

Methodologically, researchers have studied the structural requirements by:

  • Using gene cloning techniques to isolate specific regions (e.g., exon 6 and flanking regions)

  • Creating expression vectors (such as pET01) containing wild-type or mutant variants

  • Transiently expressing these constructs in cell lines (e.g., COS7 cells)

  • Analyzing the resulting transcripts via RT-PCR to assess proper splicing

What methods are commonly employed to detect and quantify NDC1 expression in tissues?

Several complementary approaches are used to study NDC1 expression:

MethodApplicationAdvantages
RT-PCRmRNA quantificationAllows detection of splice variants, high sensitivity
Western blottingProtein expression levelsProvides information on protein size and post-translational modifications
ImmunohistochemistryTissue localizationPreserves spatial context in tissues
RNA-seqTranscriptome-wide analysisEnables comparison across multiple tissues/conditions
ProteomicsProtein interaction networksIdentifies binding partners and complexes

For transcriptomic analysis, researchers often access data from public repositories such as TCGA, GTEx, and CCLE databases, allowing comparisons of NDC1 expression across multiple tissue types and disease states .

What are the most effective approaches for recombinant expression of mouse NDC1?

For recombinant expression of mouse NDC1, researchers typically:

  • Clone the full-length Tmem48 cDNA or specific domains into expression vectors compatible with mammalian expression systems

  • Transform or transfect the constructs into appropriate host cells (COS7 cells have been documented as effective )

  • Optimize transfection conditions using reagents such as FuGENE 6

  • Extract RNA or protein for downstream applications

For functional studies, expression systems should maintain the natural transmembrane topology of NDC1. When studying mutant variants, researchers often clone DNA fragments containing specific exons (such as exon 6) and their flanking regions into vectors like pET01 .

How can researchers effectively modulate NDC1 expression for functional studies?

Several approaches have been validated for modulating NDC1 expression:

  • Knockdown strategies:

    • siRNA or shRNA delivery (typically via lipofection)

    • CRISPR-Cas9 mediated deletion (as employed in C. elegans studies )

    • miRNA-based regulation (e.g., miR-421 has been shown to inhibit NDC1 expression in A549 NSCLC cells )

  • Overexpression approaches:

    • Transient transfection with expression vectors

    • Stable cell line generation using antibiotic selection

    • Viral transduction systems for difficult-to-transfect cells

Effectiveness can be validated using cell viability assays (MTT, CCK-8), proliferation assays (EdU labeling), and protein expression confirmation via Western blotting .

What experimental assays can assess NDC1's functional impact on cellular processes?

Based on established research protocols, the following assays effectively measure NDC1's functional effects:

  • Proliferation assays:

    • MTT assay: Cells are inoculated into 96-well plates (5×10³ cells/well) and viability is measured at 24, 48, 72, and 96 hours post-treatment

    • EdU labeling: Provides visual confirmation of DNA synthesis in proliferating cells

  • Migration assays:

    • Wound healing assay: Creating an artificial wound using a 200μL pipette tip on monolayer cells, followed by monitoring closure over 24 hours

    • Clone formation experiments: Assess long-term proliferative capacity following NDC1 modulation

  • Invasion assays:

    • Transwell assay: Measures the ability of cells to invade through extracellular matrix

  • Apoptosis detection:

    • Annexin V-FITC/PI flow cytometry: Quantifies early and late apoptotic cells

    • Western blotting for apoptosis markers (e.g., Caspase3, PTEN, TP53)

How does NDC1 contribute to cancer progression mechanisms?

NDC1 has emerged as a significant factor in multiple cancer types, with mechanistic studies revealing multiple pathways of influence:

Cancer TypeNDC1 RoleMolecular Mechanism
NSCLCOncogenicPromotes proliferation, adhesion, migration, invasion; inhibits apoptosis
Esophageal squamous cell carcinomaPrognostic markerIndependent prognostic factor
Colon cancerPrognostic markerIndependent prognostic factor
Cervical cancerOncogenicActivates Wnt/β-catenin pathway
Hepatocellular carcinomaOncogenicPromotes migration and invasion; immunotherapy predictor

Mechanistically, NDC1 knockdown experiments demonstrate:

  • Enhanced E-cadherin expression (epithelial marker)

  • Reduced Vimentin expression (mesenchymal marker)

  • Indicating NDC1 likely promotes epithelial-mesenchymal transition in cancer cells

What is the role of Tmem48 mutation in mouse gametogenesis and development?

The skeletal fusions with sterility (sks) mouse model demonstrates a critical role for NDC1 in developmental processes:

  • The autosomal recessive mutation in Tmem48 results in:

    • Male and female sterility due to defects in gametogenesis

    • Skeletal malformations

  • Molecular basis:

    • The mutation causes aberrant splicing, specifically deleting exon 6 of the Tmem48 transcript

    • The defective protein disrupts nuclear pore complex function

  • Experimental validation:

    • Complete phenotypic rescue was achieved through transgenesis of a genomic fragment containing wild-type Tmem48

    • Specific expression of TMEM48 was observed in germ cells of both males and females

This model provides compelling evidence that the nuclear pore complex plays an essential role in mammalian gametogenesis and skeletal development, with NDC1 serving as a key component in these processes .

How does NDC1 interact with other nuclear pore complex components?

NDC1 functions through specific interactions with other nuclear pore complex proteins:

  • Nup53 interaction:

    • NDC1 binds directly to Nup53, which links the inner and outer rings of the NPC

    • This interaction connects to the central channel through Nup53's association with the Nup96/98 complex and Nup155

    • NDC1 and Nup53 function in parallel to drive nuclear assembly

  • NUP155 interaction:

    • NUP155 and NDC1 interaction has been specifically implicated in NSCLC progression

    • This interaction represents a promising target for therapeutic intervention in cancer research

  • Recruitment function:

    • NDC1 promotes the stable association of outer ring scaffold components in the nuclear envelope

    • It is recruited early to the nuclear rim and localizes to the ER and cytoplasmic puncta

    • This recruitment is essential for proper post-mitotic NPC assembly

What molecular pathways are regulated by NDC1 in normal and disease states?

NDC1 influences several key cellular pathways:

  • Nuclear transport pathway:

    • NDC1 is essential for proper nuclear pore complex assembly

    • When NDC1 function is compromised, nuclear transport is delayed in post-mitotic cells

  • Wnt/β-catenin signaling:

    • NDC1 has been demonstrated to advance cervical cancer progression via the Wnt/β-catenin pathway

    • This suggests a role beyond structural nuclear pore function

  • Apoptotic regulation:

    • NDC1 suppression increases apoptosis-related gene expression (Caspase3, PTEN, TP53)

    • miR-421 inhibits NDC1 expression in NSCLC cells, thereby promoting apoptosis

  • Cell adhesion and migration pathways:

    • NDC1 knockdown inhibits cell adhesion, migration, and invasion

    • NDC1 modulates epithelial-mesenchymal transition markers (E-cadherin and Vimentin)

How can NDC1 be targeted for potential therapeutic applications?

Based on current research, several targeting strategies show promise:

  • Direct targeting approaches:

    • RNAi-based therapies (siRNA, shRNA) to reduce NDC1 expression

    • CRISPR-Cas9 gene editing to disrupt NDC1 function

    • Small molecule inhibitors targeting NDC1 protein interactions

  • Indirect targeting mechanisms:

    • miRNA delivery (e.g., miR-421) to downregulate NDC1 expression

    • Targeting the Wnt/β-catenin pathway to counteract NDC1's oncogenic effects

    • Combination approaches with standard chemotherapies

  • Biomarker applications:

    • NDC1 expression levels as prognostic indicators

    • Development of nomogram models incorporating NDC1 expression with other clinical features for cancer prognosis

For therapeutic applications, researchers have developed calibration curves and nomogram models based on NDC1 expression and clinical features to predict patient outcomes, demonstrating the translational potential of NDC1 research .

What experimental designs can help resolve contradictory findings about NDC1 function?

When confronting contradictory data about NDC1 function, researchers should consider:

  • Tissue/cell type specificity:

    • Design experiments comparing NDC1 function across multiple cell types

    • Use tissue-specific knockout or knockdown approaches

    • Conduct weighted correlation network analysis (WGCNA) to identify co-expressed genes and their association with clinical traits

  • Context-dependent function analysis:

    • Investigate NDC1 under various cellular stresses (e.g., serum starvation, hypoxia)

    • Assess function in the context of cell cycle phases

    • Examine NDC1's role during development versus homeostasis

  • Comprehensive pathway analysis:

    • Perform GO and KEGG enrichment analysis on gene modules associated with NDC1

    • Use the "ClusterProfiler" R package to conduct functional annotation

    • Consider P < 0.05 or q < 0.05 as statistically significant thresholds for enrichment studies

  • Rescue experiments:

    • Conduct complementation studies with wild-type versus mutant NDC1

    • Perform domain-specific rescue experiments to identify critical functional regions

    • Design experiments similar to the complete phenotypic rescue achieved in sks mice through wild-type Tmem48 transgenesis

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.