Recombinant Mouse Olfactory receptor 1002 (Olfr1002)

What is Olfactory Receptor 1002 (Olfr1002) and what is its role in the mouse olfactory system?

Olfr1002, also known as Olfactory receptor 175-2 (Mor175-2), is a G protein-coupled receptor expressed in mouse olfactory sensory neurons . Like other olfactory receptors, Olfr1002 is responsible for the recognition and G protein-mediated transduction of odorant signals, serving as a primary detector in the olfactory system . Olfactory receptors function as the initial point of contact between environmental chemical stimuli and the neural processing system.

The receptor contains 318 amino acids and adopts the characteristic seven-transmembrane domain structure common to many neurotransmitter and hormone receptors . This structural arrangement allows Olfr1002 to bind specific odorant molecules, initiating a signaling cascade that ultimately leads to the perception of specific odors. The receptor is encoded by the Olfr1002 gene, with the synonym Mor175-2, and has been assigned the UniProt identification number Q8VFK2 .

Within the mouse olfactory system, Olfr1002 contributes to the remarkable ability to detect and discriminate between thousands of different odors. Individual olfactory sensory neurons typically express only one olfactory receptor type, and neurons expressing the same receptor converge onto specific glomeruli in the olfactory bulb, creating a spatial map of odor information.

What is the amino acid sequence and structural characteristics of Olfr1002?

The full amino acid sequence of mouse Olfr1002 consists of 318 amino acids with the expression region spanning positions 1-318 . The complete sequence is as follows:

MMHRNQTVVTEFFFTGLTSSFHLQIVLFLTFLCVYLATLLGNLGMIILIHQDTRLHIPMY
FFLSHLSFVDACSSSVISPLMSDIFVDKKVISFLGCAIQCLFFSQFVVTECFLLASMAY
DRYVAICKPLLYTLIMSQRVCVQLVIGPYSIGLISTVVHTTSAFILPYCGPNLINHFFCD
LLPVLSLACADTQMNKHLLFIMAGILGVFSGIIILVSYVYIAITILKINSADGRRKAFST
CSSHLLAVSILYGVLFFIYVRPSSSFSLDINKVVSLFYTAVIPMLNPFIYSLRNKEVKDA
LIRTFEKKFCYSLQDKIL

Structurally, Olfr1002 exhibits the canonical features of olfactory receptors, including seven hydrophobic transmembrane domains that anchor the protein within the cell membrane . These transmembrane regions are connected by alternating extracellular and intracellular loops. The extracellular portions, particularly the N-terminal region and extracellular loops, contain the odor-binding pocket that determines the receptor's odorant specificity.

The amino acid composition reveals several conserved motifs characteristic of G protein-coupled receptors, including specific residues that are critical for signal transduction. The transmembrane regions contain predominantly hydrophobic residues, while the loops feature more polar and charged amino acids that facilitate interactions with intracellular signaling molecules and extracellular odorants.

How does recombinant Olfr1002 differ from native Olfr1002 in experimental applications?

Recombinant Olfr1002 provides researchers with a purified and standardized form of the receptor that can be used in controlled experimental settings . Unlike native Olfr1002, which exists within the complex cellular environment of olfactory sensory neurons, recombinant Olfr1002 is produced through expression systems that allow for specific modifications, such as the addition of tags for detection and purification.

The recombinant form is typically stored in a Tris-based buffer with 50% glycerol that has been optimized to maintain protein stability . This formulation allows for extended storage at -20°C or -80°C, though repeated freezing and thawing is not recommended as it may compromise protein integrity. Working aliquots can be maintained at 4°C for up to one week .

In experimental applications, recombinant Olfr1002 enables studies that would be challenging with the native receptor, including:

• In vitro binding assays to identify specific ligands

• Structural studies to elucidate receptor conformation

• Biochemical analyses of receptor-ligand interactions

• Development of antibodies against specific receptor epitopes

• Functional reconstitution in heterologous expression systems

How does Olfr1002 contribute to the adaptation mechanisms observed in the olfactory system?

Recent research on olfactory adaptation provides insights into how receptors like Olfr1002 may contribute to dynamic sensitivity adjustments in the olfactory system. Adaptation refers to the decrease in response amplitude that occurs with repeated or prolonged odor exposure, and it appears to operate through multiple mechanisms at different levels of the olfactory pathway .

Studies using 2-photon Ca²⁺ imaging in awake mice have revealed that adaptation occurs heterogeneously across the glomerular population, with some glomeruli maintaining consistent response patterns while others show significant decreases in activity with repeated stimulation . This selective adaptation persists for up to 30 seconds after odor exposure and is concentration-dependent, being more pronounced at higher odor concentrations .

For receptors like Olfr1002, adaptation may occur through several mechanisms:

• Receptor desensitization via phosphorylation

• Internalization of receptors from the cell membrane

• Depletion of second messenger components

• Feedback inhibition from downstream signaling elements

Experimental evidence suggests that much of the adaptation occurs at the level of the olfactory bulb rather than in the olfactory receptor neurons themselves. When researchers compared adaptation in olfactory receptor neuron glomeruli with that in mitral/tufted cell glomeruli, they found that the receptor neurons exhibited minimal adaptation while substantial adaptation was observed in the output neurons of the olfactory bulb .

This finding suggests that Olfr1002 and other olfactory receptors maintain relatively stable signaling properties, but their signals undergo selective modulation at subsequent processing stages. This arrangement may allow the olfactory system to maintain sensitivity to novel odors while attenuating responses to persistent background stimuli.

What experimental approaches are most effective for studying Olfr1002 function in neural circuits?

Investigating Olfr1002 function within neural circuits requires sophisticated techniques that can track receptor activity in real-time while maintaining physiological relevance. Several complementary approaches have proven effective:

In vivo calcium imaging stands out as a particularly powerful method for studying olfactory receptor function within intact neural circuits. Using transgenic mice expressing calcium indicators (such as GCaMP6s) in specific neuronal populations, researchers can visualize activity patterns across multiple glomeruli simultaneously . This approach has revealed that glomerular responses to odors remain remarkably stable across different imaging sessions, with high correlation coefficients between trials (r = 0.72 ± 0.05) .

For more targeted studies of Olfr1002 specifically, genetic approaches like the Cre-loxP system can be employed. The Tbx21-Cre transgenic mouse line has been used successfully to express calcium indicators selectively in mitral/tufted cells, allowing for specific imaging of olfactory bulb output signals . A similar approach could potentially target Olfr1002-expressing neurons.

Whole-cell patch-clamp electrophysiology provides detailed information about the electrical properties of individual neurons and their responses to odorants. This technique can be combined with optogenetic stimulation to precisely control neural activity while measuring responses. For studying adaptation, designs incorporating varied interstimulus intervals (6-30 seconds) have revealed concentration-dependent effects on response magnitude .

Modern circuit tracing techniques, such as viral-mediated expression of fluorescent proteins or trans-synaptic tracers, can map the connectivity of Olfr1002-expressing neurons through the olfactory bulb and into higher brain regions. This approach helps elucidate how information from this specific receptor is integrated into broader neural networks.

How does genetic variation in Olfr1002 affect odorant binding and signal transduction?

The functional consequences of genetic variation in Olfr1002 remain an active area of research, with implications for understanding individual differences in olfactory perception. Studies of olfactory receptors have revealed that even single amino acid substitutions can dramatically alter odorant binding specificity and efficacy.

For Olfr1002, several regions within the protein sequence are likely to be particularly important for odorant binding and signal transduction:

• The extracellular loops and N-terminal domain, which contain residues that directly interact with odorant molecules

• The transmembrane domains, which form the binding pocket and undergo conformational changes upon odorant binding

• The intracellular loops and C-terminal domain, which interact with G proteins and other signaling molecules

Natural genetic variants of Olfr1002 may exhibit altered binding profiles for specific odorants, potentially contributing to strain differences in olfactory perception among mice. These variations could affect:

• The range of odorants recognized by the receptor

• The binding affinity for specific odorants

• The efficiency of G protein coupling and downstream signal amplification

• The receptor's susceptibility to adaptation

To study these effects, researchers can employ site-directed mutagenesis to create recombinant Olfr1002 variants with specific amino acid substitutions, followed by functional assays to assess changes in binding and signaling properties. Alternatively, CRISPR-Cas9 gene editing can be used to introduce specific mutations into the endogenous Olfr1002 gene in mice, allowing for in vivo assessment of functional consequences.

What are the optimal conditions for working with recombinant Olfr1002 protein in binding assays?

Working with recombinant Olfr1002 requires careful attention to storage, handling, and experimental conditions to maintain protein functionality. Based on available information about recombinant olfactory receptors, the following guidelines can help optimize binding assay performance:

Storage and Preparation:

• Store stock solution at -20°C for routine use or -80°C for long-term storage

• Avoid repeated freeze-thaw cycles by preparing single-use aliquots

• Working aliquots can be maintained at 4°C for up to one week

• When thawing, allow the protein to warm gradually to room temperature (approximately 10 minutes) followed by gentle mixing

Buffer Conditions:

• Use Tris-based buffers with 50% glycerol as a starting point, as these have been optimized for olfactory receptor stability

• Consider including protease inhibitors to prevent degradation

• Some researchers incorporate detergents like n-dodecyl-β-D-maltoside (DDM) at concentrations below the critical micelle concentration to maintain receptor solubility without disrupting structure

Binding Assay Design:

• Temperature: Conduct binding reactions at 25°C (room temperature) to balance between physiological relevance and protein stability

• pH: Maintain pH between 7.0-7.4 to mimic physiological conditions

• Incubation time: Typical binding equilibration occurs within 60-90 minutes

• Control reactions: Include both positive controls (known ligands) and negative controls (buffer only)

• Competition assays: Use a known ligand at fixed concentration and vary test compounds to determine relative binding affinities

Detection Methods:

• Fluorescence-based assays using environment-sensitive dyes

• Surface plasmon resonance for real-time binding kinetics

• Isothermal titration calorimetry for thermodynamic parameters

• Radiolabeled ligand binding for quantitative affinity determination

For validation, researchers should confirm that the recombinant Olfr1002 shows specific binding to odorants known to activate this receptor class. Testing multiple concentrations of ligands (typically ranging from 10⁻⁹ to 10⁻⁴ M) allows for the construction of dose-response curves and determination of EC₅₀ values.

How can researchers design experiments to investigate Olfr1002's role in olfactory adaptation?

Designing experiments to elucidate Olfr1002's specific role in olfactory adaptation requires approaches that can distinguish receptor-level adaptation from circuit-level effects. Based on recent research in the field, several experimental designs would be particularly informative:

In Vivo Calcium Imaging with Variable Interstimulus Intervals:
This approach allows researchers to track adaptation dynamics across multiple timescales. Recent studies have shown that adaptation is highly dependent on both odor concentration and interstimulus interval . For Olfr1002-specific investigations, researchers could:

• Express GCaMP6s in Olfr1002-expressing neurons using targeted genetic approaches

• Deliver odors with varying interstimulus intervals (6, 30, and 180 seconds)

• Test multiple odor concentrations (e.g., 0.5%, 1.5%, and 3.5% of saturated vapor)

• Quantify the percentage of adaptation ([1st response - 3rd response]/1st response × 100%)

This design has revealed that different glomeruli exhibit varying degrees of adaptation to the same stimulus, with some showing minimal changes while others display up to 80% reduction in response amplitude .

Comparative Adaptation Analysis:
To determine whether adaptation occurs primarily at the receptor level or at later processing stages, researchers can simultaneously image from:

• Olfactory receptor neurons expressing Olfr1002 (input)

• Mitral/tufted cells receiving input from Olfr1002-expressing neurons (output)

Recent studies indicate that olfactory receptor neurons exhibit minimal adaptation while substantial adaptation occurs in mitral/tufted cells, suggesting that much of the adaptive processing happens at the circuit level rather than at individual receptors .

Pharmacological Manipulation:
Blocking specific signaling pathways can help isolate the mechanisms of adaptation:

• G protein inhibitors to block receptor-mediated signaling

• Protein kinase inhibitors to prevent receptor phosphorylation

• Internalization inhibitors to prevent receptor endocytosis

• Synaptic transmission blockers to isolate receptor-level from circuit-level effects

Control for Respiratory Variables:
Since respiration patterns can affect odor delivery and neural responses, researchers should monitor breathing during experiments. This can be accomplished using thermistors placed near the nostril or pressure sensors in the nasal cavity . Analysis should confirm that respiratory patterns remain consistent across experimental conditions.

What considerations are important when designing studies to compare Olfr1002 with other olfactory receptors?

Comparative studies of olfactory receptors provide valuable insights into the principles governing odor coding and receptor evolution. When designing studies to compare Olfr1002 with other olfactory receptors, researchers should consider several important factors:

Receptor Selection Criteria:

• Phylogenetic relationship: Include receptors with varying degrees of sequence similarity to Olfr1002

• Expression patterns: Consider receptors expressed in similar or different zones of the olfactory epithelium

• Known ligand profiles: Include receptors with overlapping, complementary, or distinct odor recognition profiles

• Evolutionary conservation: Compare with orthologous receptors from different species

Standardized Expression Systems:
To make valid comparisons, all receptors should be expressed under identical conditions:

• Use the same expression vector and promoter for all constructs

• Verify comparable expression levels through Western blot or flow cytometry

• Confirm proper membrane localization using confocal microscopy

• Include positive controls (well-characterized receptors) and negative controls (empty vectors)

Heterologous expression systems like HEK293T cells are commonly used, though they may lack some of the specialized machinery found in olfactory sensory neurons. To address this limitation, some researchers co-express accessory proteins like Receptor Transporting Protein 1 (RTP1) and Receptor Expression Enhancing Protein 1 (REEP1) to improve trafficking to the plasma membrane.

Ligand Selection Strategy:
Design a panel of test odorants that:

• Spans diverse chemical classes (aldehydes, esters, ketones, etc.)

• Includes known ligands for Olfr1002 and comparison receptors

• Contains structurally related compounds that vary in systematic ways (chain length, functional groups, etc.)

• Represents ecologically relevant odors for the species being studied

Response Measurement:
Use multiple complementary methods to assess receptor activation:

• Calcium imaging for real-time visualization of response dynamics

• cAMP assays to quantify second messenger production

• Electrophysiology for high temporal resolution measurements

• GTPγS binding assays to measure G protein coupling efficiency

Data Analysis Framework:
Develop a systematic approach to compare receptor properties:

• Generate concentration-response curves for each receptor-ligand pair

• Calculate EC₅₀ values to quantify potency

• Determine efficacy (maximum response amplitude)

• Construct tuning curves to visualize receptor selectivity profiles

• Apply dimensionality reduction techniques (PCA, t-SNE) to visualize relationships between receptors based on response profiles

How should researchers interpret conflicting data on Olfr1002 responses across different experimental paradigms?

When faced with conflicting data on Olfr1002 responses across different experimental paradigms, researchers should undertake a systematic analysis to identify the sources of variability and determine which findings most accurately reflect the receptor's true biological properties.

Sources of Experimental Variability:
Conflicting results may stem from differences in:

• Preparation types: Results from in vitro receptor expression systems often differ from in vivo recordings. Recent studies have shown that glomerular responses measured in awake mice can differ substantially from those in anesthetized preparations .

• Measurement techniques: Different techniques (calcium imaging, electrophysiology, cAMP assays) measure distinct aspects of the signaling cascade with varying temporal resolution and sensitivity. For instance, calcium imaging captures population-level activity but may miss rapid kinetics that electrophysiology can detect.

• Expression systems: When expressed in heterologous cells, Olfr1002 may lack the native cellular machinery present in olfactory sensory neurons. Comparative studies should test whether accessory proteins affect response properties.

• Animal models: Strain differences in mice can affect receptor sequence, expression levels, or processing circuitry. Research has shown that glomerular responses can vary between imaging sessions, with some glomeruli exhibiting consistent responses while others show variability (e.g., ROI 14 in a recent study) .

• Experimental conditions: Temperature, pH, ionic composition, and other experimental variables can significantly impact receptor function and should be carefully controlled and reported.

Reconciliation Strategies:
To reconcile conflicting data, researchers should:

• Perform direct comparisons using multiple techniques on the same preparation

• Replicate key findings across different laboratories and experimental paradigms

• Conduct dose-response studies to determine if apparent conflicts reflect differences in sensitivity rather than specificity

• Consider the possibility that different measurement techniques capture distinct aspects of receptor function

Statistical Considerations:
Recent research has demonstrated that reliable characterization of olfactory responses requires multiple trials. Analysis of glomerular population responses showed that reliable response profiles require averaging at least 4-6 trials to obtain a representative response . This suggests that apparent conflicts may sometimes reflect sampling variability rather than true biological differences.

When evaluating data quality, researchers should consider correlation coefficients between repeated measurements. In reliable preparations, odor-evoked responses show high correlations during stimulus presentation (r = 0.62 ± 0.02 for methyl valerate responses) but not during baseline periods (r = 0.08 ± 0.01) .

What statistical approaches are most appropriate for analyzing adaptation in Olfr1002-expressing neurons?

Appropriate statistical approaches for analyzing adaptation in Olfr1002-expressing neurons should address both the magnitude of adaptation and its heterogeneity across the neuronal population. Based on recent research methodologies, the following statistical frameworks are recommended:

Quantification of Adaptation Magnitude:
For individual neurons or glomeruli:

• Calculate the adaptation index (AI) as: AI = (R₁ - Rₙ)/R₁ × 100%
  Where R₁ is the response to the first stimulus and Rₙ is the response to the nth stimulus

• This normalized measure allows for comparison across neurons with different baseline response magnitudes

For comparing adaptation across conditions:

• Two-way ANOVA with repeated measures to assess the effects of concentration and interstimulus interval on adaptation

• Post-hoc tests (e.g., Tukey's HSD) to identify specific differences between conditions

Population-Level Analysis:

• Calculate the percentage of significantly adapted glomeruli within the population

• Recent studies defined significant adaptation as >20% decrease in response amplitude with p < 0.05

• Wilcoxon ranksum test to compare adaptation across different experimental conditions (as used in recent studies comparing adaptation at different concentrations)

Correlation Analysis:

• Calculate correlation coefficients between responses to successive odor presentations

• Compare within-day versus between-day correlations to distinguish adaptation from general response variability

• As demonstrated in recent research, the mean correlation coefficient for trials recorded on the same day (0.72 ± 0.05) can be compared with those measured during different imaging sessions (0.72 ± 0.05, p = 0.77)

Time Course Analysis:

• Exponential decay models to characterize the recovery from adaptation

• Fit response amplitudes across different interstimulus intervals to equations of the form:
  R(t) = R₀ + (Rₘₐₓ - R₀)(1 - e^(-t/τ))
  Where τ represents the recovery time constant

Respiratory Control Analysis:
Since respiration can affect odor delivery and neural responses, statistical models should include:

• Comparison of inhalation rates across stimulus presentations

• ANCOVA with respiratory parameters as covariates

• Verification that respiratory patterns are not significantly different between experimental conditions that show different adaptation profiles

How can transcriptomic and proteomic data be integrated to better understand Olfr1002 function?

Integrating transcriptomic and proteomic data provides a comprehensive view of Olfr1002 function within the broader context of olfactory signal transduction. This multi-omics approach reveals not only the expression patterns of the receptor itself but also the supporting molecular machinery that influences its function.

RNA-Seq Data Analysis:
Transcriptomic data can reveal:

• Expression levels of Olfr1002 across different developmental stages

• Co-expressed genes that may function in the same signaling pathway

• Alternative splicing variants that could have distinct functional properties

• Regulatory factors controlling Olfr1002 expression

Key analytical approaches include:

• Differential expression analysis to identify conditions that modulate Olfr1002 expression

• Co-expression network analysis to identify genes with similar expression patterns

• Enrichment analysis to identify overrepresented pathways among co-expressed genes

• Single-cell RNA-seq to determine the precise cellular context of Olfr1002 expression

Proteomic Data Integration:
Proteomic analyses provide complementary information about:

• Post-translational modifications of Olfr1002 that may regulate its activity

• Protein-protein interactions that mediate signal transduction

• Subcellular localization of Olfr1002 and associated proteins

• Protein turnover rates that may influence adaptation kinetics

Techniques for proteomic characterization include:

• Immunoprecipitation followed by mass spectrometry to identify interacting partners

• Phosphoproteomics to map phosphorylation sites involved in receptor desensitization

• Spatial proteomics to determine the subcellular distribution of signaling components

• APEX2 proximity labeling to identify proteins in the vicinity of Olfr1002

Integration Frameworks:
Several computational approaches can integrate these diverse data types:

• Correlation analysis between transcript and protein levels to identify post-transcriptional regulation

• Pathway enrichment using both RNA and protein data to identify robust biological processes

• Network modeling to link transcriptional regulators to their protein targets

• Machine learning approaches to predict functional outcomes based on multi-omics signatures

Case Study: Adaptation Mechanisms
Integrating transcriptomic and proteomic data is particularly valuable for understanding adaptation mechanisms. For example, recent research has shown that adaptation in the olfactory bulb is heterogeneous across the glomerular population and is more pronounced at higher odor concentrations . This phenomenon could be explained by:

• Differential expression of phosphodiesterases that terminate cAMP signaling

• Varying levels of receptor kinases that phosphorylate activated receptors

• Distinct patterns of internalization machinery expression

• Differences in calcium buffering capacity across cell types

By mapping these components at both RNA and protein levels, researchers can build predictive models of which neurons are most susceptible to adaptation and the molecular mechanisms responsible for this differential sensitivity.