Recombinant Mouse Olfactory receptor 1013 (Olfr1013)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please include your preferred format in the order notes, and we will prepare accordingly.
Lead Time
Delivery time may vary based on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. Should you require dry ice shipping, please contact us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%, serving as a guideline for your reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. For multiple use, aliquoting is essential to avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Olfr1013; Mor213-2; Olfactory receptor 1013; Olfactory receptor 213-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-305
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Olfr1013
Target Protein Sequence
MDQNNNTVSEFIMLGFTTDPVIQKVLFAVFLVVYTLTLMGNSSLIMLICNDSRLHTPMYF FIGNLSFLDLGLSSVYTPKILETCISEDKSISFAGCVAQFFFSAALDYTECYLLAAMAYD RYVAISKPLLYSQAMSLKLCVCFVVASYVGGFINSVIITKDTFALTFCNDNVIDDFFCDI PPLVKLACGKKKSFQSVLFFLLTSNVIIPIVFILATYLFIIATILRIRSTQGRLKAFSTC SSHLISVTLYYGSILYIYARPRSSYSLDRDKIVSTFYTVVFPMLNPLIYSLRNKDVKEAL NKLLK
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Olfr1013 and what cellular systems are optimal for its recombinant expression?

Olfr1013 is a G protein-coupled receptor (GPCR) expressed in olfactory sensory neurons (OSNs) in the mouse olfactory epithelium. Like other mammalian ORs, its functional characterization presents significant challenges due to complex trafficking and signaling mechanisms.

For recombinant expression, researchers should consider both heterologous cell culture systems and in vivo models:

Expression SystemAdvantagesLimitationsBest Applications
HEK293 cellsHigh transfection efficiency, established for OR studiesMay require additional chaperones for proper folding, non-native cellular environmentHigh-throughput screening, structure-function studies
OSN-derived cell linesMore native-like cellular environmentLower expression levels, more challenging transfectionDetailed signaling studies
In vivo AAV-mediated expressionNative cellular environment, physiological G-protein couplingMore complex implementation, higher variabilityFunctional characterization in native context

When expressing Olfr1013 in heterologous systems, success rates increase when using rho-tag sequences or co-expressing with receptor transporting proteins (RTPs) and receptor expression enhancing proteins (REEPs) .

How does in vitro recombinant Olfr1013 characterization compare to in vivo approaches?

The cellular environment significantly impacts OR functionality, resulting in potential discrepancies between in vitro and in vivo characterization:

In vitro systems using HEK293 cells with calcium imaging or luciferase-based cAMP assays offer high-throughput capabilities but may not fully recapitulate native receptor behavior. Research with Olfr73 revealed that antagonism observed in vitro was not consistently replicated in vivo, particularly during prolonged odor exposure .

In vivo approaches using AAV-mediated expression of Olfr1013 in OSNs preserve the native cellular environment, signal transduction machinery, and stimulus dynamics. This approach more accurately captures physiological ligand-receptor interactions as demonstrated with other ORs .

The methodological choice depends on research objectives:

  • For initial ligand screening: in vitro high-throughput assays

  • For understanding physiological relevance: in vivo expression using AAV gene delivery followed by calcium imaging or electrophysiology

What are the recommended protocols for AAV-mediated expression of Olfr1013 in olfactory sensory neurons?

For functional characterization of Olfr1013 in a native cellular environment, AAV-mediated gene delivery offers significant advantages:

Protocol overview:

  • Construct a bicistronic AAV vector containing:

    • Olfr1013 gene (with or without epitope tag)

    • IRES sequence

    • Fluorescent calcium indicator (e.g., GCaMP3)

  • Package the construct into an AAV5 serotype (optimal for olfactory epithelium transduction)

  • Administer via intranasal delivery:

    • Anesthetize mice (mixed 129SvEv; C57BL/6 background recommended)

    • Deliver 1-5 μL of purified virus (>10^12 vg/mL) to each nostril

    • Allow 2-3 weeks for expression

  • Verify expression through fluorescence of the calcium indicator in OSN dendritic knobs and cilia

This approach enables visualization of functional activity within the transduction compartment with high resolution, allowing for robust characterization of odorant responses.

What techniques are most effective for measuring Olfr1013 activation in recombinant systems?

Several complementary techniques can be employed to characterize Olfr1013 activation:

In vitro calcium imaging:

  • Co-express Olfr1013 with Gα15 or Golf and calcium indicators

  • Record responses to brief (5-second) odorant pulses

  • Analyze response kinetics and concentration-dependence

  • Compatible with high-throughput screening

SEAP/luciferase reporter assays:

  • Utilize cAMP-dependent upregulation of a Cre response element fused to SEAP phosphatase or luciferase

  • Suitable for prolonged (30-minute) odorant exposure

  • Enables screening for both agonists and antagonists

In vivo calcium imaging of transduced OSNs:

  • Express Olfr1013 with GCaMP3 via AAV delivery

  • Visualize odor-evoked global cilia-to-knob responses in semi-intact tissue

  • Analyze concentration-response functions (EC50 values)

  • More physiologically relevant but lower throughput

Each method offers distinct advantages, with the combination providing comprehensive characterization of receptor properties in different contexts.

How can researchers analyze mixture interactions at Olfr1013?

Analysis of mixture interactions at ORs requires specialized approaches to distinguish between agonism, antagonism, and additive effects:

Experimental design for mixture analysis:

  • Establish response profiles to individual compounds at varying concentrations

  • Test binary mixtures with one component at a fixed concentration

  • Compare observed responses to predicted additive responses

  • Plot concentration-response functions for comprehensive analysis

When analyzing Olfr1013 mixture interactions, researchers should consider:

  • Testing both short (5-second) and prolonged (10-30 minute) stimulus application

  • Examining potential differences between in vitro and in vivo systems

  • Characterizing both excitatory and inhibitory responses

Research with Olfr73 revealed that antagonism observed with short odor pulses was not reproduced with prolonged exposure, highlighting the importance of stimulus dynamics in mixture interactions .

What genetic approaches can be used to express and study Olfr1013 in specific neuronal populations?

Genetic tools provide precise control over Olfr1013 expression for targeted studies:

Cre-driver lines:

  • Lbhd2-CreERT2 allows tamoxifen dose-dependent labeling of mitral cells

  • Enables temporal control of expression through inducible systems

  • Suitable for both male and female mice

CRISPR/Cas9-mediated gene editing:

  • Generate targeted knock-in lines expressing Olfr1013 under specific promoters

  • Create fusion constructs with reporter proteins for expression monitoring

  • Develop conditional expression systems through insertion of loxP sites

Rabies virus-mediated expression:

  • Use replication-deficient recombinant rabies virus (RVΔG) for retrograde labeling

  • Express both Olfr1013 and calcium indicators (e.g., GCaMP3) in targeted neurons

  • Perform experiments within 5-7 days post-infection to avoid toxicity

These approaches enable investigation of Olfr1013 function within specific components of the olfactory circuit.

How can researchers design experiments to identify agonists and antagonists for Olfr1013?

Systematic approaches for identifying Olfr1013 ligands include:

High-throughput in vitro screening:

  • Express Olfr1013 in HEK293 cells with cAMP-dependent reporters

  • Screen compound libraries at multiple concentrations

  • Identify initial hits based on activation or inhibition

  • Confirm with concentration-response curves

  • Validate hits in secondary assays (e.g., calcium imaging)

Antagonist identification:

  • Identify a robust agonist through initial screening

  • Set agonist concentration at EC50 or EC80

  • Screen compounds for inhibition of agonist-induced response

  • Establish concentration-dependent inhibition curves

  • Calculate IC50 values to quantify antagonist potency

Native cell validation:

  • Test identified compounds in OSNs expressing Olfr1013

  • Compare response profiles between heterologous and native systems

  • Validate antagonism in both brief pulse and prolonged exposure paradigms

Notably, some compounds identified as antagonists in vitro may act as weak agonists in vivo, as observed with methylisoeugenol for Olfr73 .

How do data analysis approaches differ between in vitro and in vivo Olfr1013 characterization?

Data analysis requirements vary significantly between experimental platforms:

In vitro calcium imaging:

  • Measure peak ΔF/F values and area under curve

  • Calculate EC50/IC50 values from concentration-response curves

  • Determine response onset kinetics and desensitization rates

  • Compare observed mixture responses to mathematical models of additivity

In vivo OSN imaging:

  • Account for background auto-fluorescence and motion artifacts

  • Analyze both global responses and subcellular compartments (cilia vs. knobs)

  • Consider left-shifted concentration–response functions compared to heterologous systems

  • Evaluate trial-to-trial variability and response adaptation

Electrophysiology:

  • Analyze both supra-threshold responses (firing rates) and sub-threshold membrane potentials

  • Distinguish between excitatory and inhibitory components

  • Correlate with respiration cycle (sniffing) during awake recordings

  • Compare responses between anesthetized and awake states

What role does the cellular environment play in Olfr1013 functionality?

The cellular environment critically influences OR function through multiple mechanisms:

G-protein coupling efficiency:

  • Native OSNs utilize Golf protein coupled to adenylyl cyclase III

  • Heterologous systems often employ promiscuous Gα15 or Golf

  • Coupling efficiency affects signal amplification and response kinetics

Compartmentalization:

  • In OSNs, ORs localize to dendritic knobs and cilia

  • Heterologous systems lack this specialized compartmentalization

  • Impacts spatial aspects of signal transduction

Inhibitory mechanisms:

  • Periglomerular interneurons provide inhibition in vivo

  • Modulates response magnitude and sensitivity

  • Absent in heterologous expression systems

Signal normalization:

  • Olfactory bulb circuits transform glomerular inputs

  • Critical for extracting meaningful information from degraded inputs

  • Enables amplification of weak signals and suppression of strong inputs

Research with M71 transgenic mice demonstrated that olfactory bulb neural circuits can substantially transform glomerular inputs to generate meaningful odor representations despite massively altered primary inputs .

What are the recommended mouse strains and controls for Olfr1013 studies?

Proper experimental design requires appropriate genetic backgrounds and controls:

Recommended mouse strains:

  • Mixed 129SvEv; C57BL/6 genetic background (6-10 week-old adult mice)

  • Consistent strain usage across experimental groups to minimize variability

Essential controls:

  • Wild-type littermates for comparison with transgenic lines

  • Heterozygous Omp-ires-tTA littermates as additional controls for tetracycline-controlled expression systems

  • Untagged Olfr1013 controls when using epitope-tagged constructs

  • Empty vector/GFP-only controls for viral delivery systems

For Cre-driver experiments:

  • Use Cre-negative littermates as controls

  • Include Rosa26-stop-flox-reporter mice to verify recombination patterns

  • Implement tamoxifen dose-response studies for inducible systems

Systematic inclusion of these controls helps distinguish receptor-specific effects from methodological artifacts.

How can researchers address the technical challenges of measuring olfactory receptor-ligand interactions?

Several technical challenges complicate OR characterization, requiring specialized approaches:

Surface expression challenges:

  • Co-express with receptor transporting proteins (RTPs) and REEPs

  • Use rho-tag or Lucy-tag sequences to enhance trafficking

  • Validate surface expression through immunocytochemistry with epitope tags

Signal-to-noise optimization:

  • For calcium imaging: optimize indicator expression levels and imaging parameters

  • For electrophysiology: account for spontaneous activity and respiratory coupling

  • For reporter assays: normalize to cell number/transfection efficiency

Odorant delivery complexities:

  • Control for odorant volatility and adsorption to delivery systems

  • Verify actual vs. nominal concentrations through physicochemical measurements

  • Implement precise temporal control of stimulus delivery

Data analysis considerations:

  • Implement automated, unbiased response detection algorithms

  • Use appropriate statistical methods for sparse, high-dimensional data

  • Correct for multiple comparisons in large-scale screening

Addressing these challenges requires multidisciplinary expertise spanning molecular biology, electrophysiology, imaging, and computational approaches.

How do stimulus dynamics affect Olfr1013 response properties?

Temporal aspects of odorant presentation significantly impact OR response properties:

Short vs. prolonged stimulation:

  • Brief pulses (5 seconds): reveal initial response kinetics and peak amplitude

  • Prolonged exposure (10-30 minutes): captures adaptation and sustained components

  • Antagonism observed with brief pulses may transform to additive agonism during prolonged exposure

Response dynamics analysis:

  • Measure onset latency, time to peak, and decay kinetics

  • Quantify adaptation rates during sustained stimulation

  • Assess recovery kinetics following stimulus termination

Physiological relevance:

  • Natural sniffing involves brief, repetitive sampling (1-10 Hz)

  • Experimental paradigms should consider ethologically relevant timescales

  • Behavioral contexts may involve both brief and prolonged exposures

Research with Olfr73 demonstrated that stimulus dynamics fundamentally alter receptor-ligand interactions, with antagonism observed only under specific temporal conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.