Recombinant Mouse Olfactory receptor 1019 (Olfr1019)

Shipped with Ice Packs
In Stock

Description

Production and Biochemical Properties

Recombinant Olfr1019 is typically expressed in E. coli or yeast systems with affinity tags for purification :

Odorant Reactivity

  • Primary Ligand: 2,4,5-Trimethylthiazoline (TMT), a component of fox odor, activates Olfr1019 with high specificity .

  • Behavioral Role: Photoactivation of Olfr1019-expressing neurons in mice induces immobility responses (freezing), a fear-associated behavior .

Key Research Findings

Study FocusMethodologyOutcome
Immobility ResponseChannelrhodopsin knock-in miceOlfr1019 activation triggers immobility via posterodorsal olfactory bulb signaling .
Knockout EffectsOlfr1019-KO miceReduced TMT-induced freezing, but not abolished (compensatory ORs) .
Signal LocalizationDual-color fluorescenceConfirmed plasma membrane localization in transfected mammalian cells .

Applications in Research

  • Olfactory Circuit Mapping: Used to identify glomerular activation patterns in the olfactory bulb .

  • Behavioral Studies: Links receptor activation to innate fear responses in mice .

  • Structural Biology: Facilitates biophysical studies of GPCR signaling due to high-yield recombinant expression .

Interactions and Pathways

While pathway data for Olfr1019 remains limited, its functional overlap with other ORs includes:

Selected Interacting Proteins

Protein/MoleculeInteraction TypeBiological Role
Gα<sub>olf</sub>Signal transductionMediates cAMP signaling cascade
TMTLigand-receptor bindingElicits fear-associated behaviors

Technical Challenges

  • Low Native Expression: Requires heterologous systems (e.g., E. coli) for scalable production .

  • Functional Assays: Ligand screening relies on calcium imaging or cAMP reporters due to lack of intrinsic enzymatic activity .

Future Directions

  • Mechanistic Studies: Elucidate structural determinants of TMT binding via cryo-EM or X-ray crystallography.

  • Behavioral Modulation: Explore Olfr1019’s role in predator-prey interactions using optogenetic tools .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will do our best to accommodate your request.
Lead Time
Delivery time may vary depending on your location and the purchase method. Please consult your local distributor for specific delivery estimates.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Olfr1019; Mor180-1; Olfactory receptor 1019; Olfactory receptor 180-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Olfr1019
Target Protein Sequence
MDKENHSVVTEFVFMGITQDPQLQIIFFVVFLLVYLVNVIGNVGMIILIITDSQLHTPMY FFLCNLSFVDLGYSSAIAPRMLADFLTKHKVISFSSCATQFAFFVGFVDAECYVLAAMAY DRFVAICRPLHYSTLMSKKVCLVLMLGSYFAGLVSLVAHTSLTFSLSYCGSNIINHFFCE IPPLLALSCSDTYISEILLFSLCGFIEFSTILIIFISYAFILIAIIRIRSAEGRLKAFST CGSHLTGVTLFYGTVMFMYLRPTSSYSLDQDKWASVFYTIIIPMLNPLIYSLRNKDVKAA FKKLIGKKPQ
Uniprot No.

Target Background

Function
Olfactory receptor 1019 (Olfr1019) is a G protein-coupled receptor activated by binding to organosulfur odorants containing thioether groups, such as (methylthio)methanethiol (MTMT). Its activation is likely mediated by G proteins, which in turn stimulate adenylyl cyclase.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does Olfr1019 function within the broader context of odor-induced behaviors?

Olfr1019 functions within a complex system where multiple olfactory receptors (ORs) may respond to the same odorant with varying sensitivities. The encoding of odor-associated valence at the receptor level involves the summation of signals from all activated receptors. Research demonstrates that individual ORs, including Olfr1019, send signals to specific neural circuitry leading to particular behaviors, thus encoding an odor-associated valence . The final behavioral output is determined by the collective valences coded by all activated ORs. This principle has been demonstrated in studies with other receptors as well, such as the concentration-dependent switch from attraction to aversion seen with Z5-14:OH, where different ORs with varying sensitivities encode attraction or aversion .

Why are Olfr1019 knockout mice important for olfactory research?

Olfr1019 knockout mice provide a critical experimental model for understanding the relationship between individual olfactory receptors and specific behavioral outputs. These models help researchers dissect the complex encoding of odor-associated valence at the receptor level. In Olfr1019 knockout mice, the immobility response to TMT is reduced but not entirely abolished, confirming that while Olfr1019 is significant, other TMT-responsive glomeruli also contribute to the defensive behavior . This model illustrates the challenge in olfactory research that odorants typically activate multiple receptors, making it impractical to simultaneously knockout dozens of ORs. Therefore, selecting odorants that activate a small number of ORs, as in the case of TMT and Olfr1019, provides a more manageable approach to study individual receptor contributions.

What are the optimal methods for detecting Olfr1019 expression in mouse olfactory tissue?

For detecting Olfr1019 expression in mouse olfactory tissue, researchers should employ a combination of techniques:

  • RNA Extraction and RT-PCR: Isolate olfactory sensory neurons from the olfactory epithelium and purify RNA using RNeasy Plus Mini Kit or similar. For RT-PCR, use 1000 ng RNA with appropriate primers for Olfr1019. Include negative controls without reverse transcriptase to confirm specificity .

  • Immunohistochemistry: For protein-level detection, perfuse mice with PBS followed by 4% paraformaldehyde, then post-fix the olfactory bulb for 3 hours. Process 30-micron coronal cryosections and incubate with primary antibodies specific to Olfr1019, followed by appropriate biotinylated secondary antibodies and visualization with 3,3′ diaminobenzidine .

  • Single-cell RNA Sequencing: For comprehensive transcriptomic profiling, dissociate olfactory epithelium into single cells and process for scRNA-seq, which allows identification of Olfr1019-expressing neurons among the diverse olfactory sensory neuron population.

Each method offers different advantages and should be selected based on specific research questions about Olfr1019 expression patterns.

How can researchers effectively measure behavioral responses mediated by Olfr1019?

To effectively measure Olfr1019-mediated behavioral responses, researchers should implement the following methodological approaches:

  • Immobility Assays: Since Olfr1019 activation induces immobility in mice, quantify freezing behavior when exposing mice to TMT. Use automated video tracking systems to measure duration and latency of immobility, comparing wild-type mice with Olfr1019 knockout mice .

  • Odor Preference Tests: Set up two-choice preference tests using TMT versus control odors to assess aversive responses. Calculate preference indices based on time spent investigating each odor source and compare between wild-type and Olfr1019 knockout mice.

  • c-Fos Activation Mapping: To correlate behavioral responses with neural activity, expose mice to TMT for 1 minute in their home cage, then sacrifice them 70 minutes later for c-Fos immunostaining. Count activated glomeruli expressing c-Fos in juxtaglomerular cells from one side of the olfactory bulb from each mouse .

  • Electro-olfactogram (EOG) Recordings: Measure field potentials of olfactory sensory neurons in response to TMT to quantify the electrophysiological response mediated by Olfr1019 and compare with knockout models .

These complementary approaches provide a comprehensive assessment of how Olfr1019 contributes to olfactory-driven behaviors.

What are the challenges in generating recombinant Olfr1019 for in vitro studies?

Generating recombinant Olfr1019 for in vitro studies presents several significant challenges:

  • Expression System Selection: Olfactory receptors are notoriously difficult to express heterologously. While HEK293T cells are commonly used, success rates for functional expression of ORs are low (similar to findings with other ORs where only OR556 showed successful expression among multiple tested receptors) .

  • Protein Trafficking Issues: Olfactory receptors often fail to traffic properly to the plasma membrane in heterologous systems. Consider using trafficking enhancers like Receptor Transporting Proteins (RTPs) or chimeric approaches that incorporate well-trafficking domains.

  • Functional Validation: Confirming functional activity requires appropriate coupling to G-protein signaling cascades. Ensure your expression system includes necessary components for cAMP production and downstream signaling when Olfr1019 is activated by TMT .

  • Proper Folding: Olfactory receptors are prone to misfolding in artificial systems. Optimize expression conditions including temperature (often lowered to 30°C), addition of glycerol or DMSO, and induction protocols to improve proper folding.

To overcome these challenges, researchers might consider using the Olfr556 expression system as a model, which has demonstrated successful heterologous expression and functional coupling to downstream signaling when co-expressed with appropriate signaling components .

How can neural circuit mapping techniques be applied to trace Olfr1019-activated pathways?

Neural circuit mapping for Olfr1019-activated pathways requires sophisticated methodological approaches:

  • c-Fos Immunostaining Protocol: After exposing mice to TMT for 1 minute, wait 70 minutes before tissue collection to allow optimal c-Fos expression. Perfuse mice with 4% paraformaldehyde, post-fix the olfactory bulb for 3 hours, and process 30-micron coronal cryosections. Use anti-c-Fos antibodies (1:500, sc-52, Santa Cruz Biotechnology) followed by biotinylated secondary antibodies and ABC amplification for visualization. This method identifies activated glomeruli and can be quantified by counting c-Fos-expressing juxtaglomerular cells .

  • Anterograde Tracing from Olfr1019-Expressing Neurons: Engineer Cre-expression under Olfr1019 promoter control, then inject Cre-dependent viral tracers (AAV-DIO-ChR2-eYFP) to visualize projection patterns of Olfr1019-expressing neurons.

  • Trans-synaptic Tracing: Use Cre-dependent, genetically modified rabies virus approaches to identify second and third-order neurons in the Olfr1019 circuit, providing insights into how this receptor connects to broader defensive behavior circuitry.

  • In Vivo Calcium Imaging: Implement GCaMP imaging in awake, behaving mice to visualize real-time activation of Olfr1019-responsive glomeruli and downstream neural circuits during TMT exposure.

These approaches provide complementary information about how Olfr1019 activation propagates through the olfactory system to drive immobility behaviors.

What mechanisms account for the partial preservation of TMT responses in Olfr1019 knockout mice?

The partial preservation of TMT responses in Olfr1019 knockout mice reveals important insights about olfactory coding redundancy:

  • Multiple Receptor Activation: TMT, like most odorants, activates multiple olfactory receptors with varying sensitivities. While Olfr1019 is a primary receptor for TMT, other receptors also respond to this compound, explaining the residual immobility response in Olfr1019 knockout mice . This multi-receptor activation is evident from c-Fos studies showing multiple activated glomeruli in response to TMT even in Olfr1019 knockout mice.

  • Compensatory Mechanisms: When Olfr1019 is deleted, other TMT-responsive receptors may undergo compensatory upregulation. Researchers should examine expression levels of other potential TMT receptors in Olfr1019 knockout mice using RNAseq or quantitative PCR approaches.

  • Parallel Pathways: TMT likely activates multiple parallel pathways in the olfactory system. Some pathways may bypass Olfr1019 entirely, utilizing other receptors that converge on the same defensive behavior circuits. Circuit mapping studies comparing wild-type and Olfr1019 knockout mice would help identify these parallel pathways.

  • Signal Amplification Systems: General signal amplification mechanisms, such as those involving Anoctamin 9 (Ano9), may enhance weak signals from other TMT-responsive receptors in the absence of Olfr1019 . This amplification could partially compensate for Olfr1019 deletion.

Understanding these mechanisms requires comparative studies between wild-type and knockout models using electrophysiological, behavioral, and molecular approaches.

How do signal amplification mechanisms like Anoctamin 9 interact with Olfr1019-mediated responses?

Signal amplification mechanisms, particularly those involving Anoctamin 9 (Ano9), may significantly impact Olfr1019-mediated responses through several pathways:

  • cAMP/PKA Pathway Integration: Anoctamin 9 functions as a cation channel activated by the cAMP/PKA pathway, which is the same pathway utilized by olfactory receptors including Olfr1019. When Olfr1019 binds TMT, it likely triggers increased cAMP levels that can activate both canonical CNG channels and Ano9, potentially amplifying the receptor signal .

  • Ciliary Co-localization: Both Olfr1019 and Ano9 are expressed in the cilia of olfactory sensory neurons, where Ano9 co-localizes with ciliary markers like acetylated tubulin. This spatial proximity facilitates functional interaction between receptor-mediated signaling and signal amplification .

  • Differential Impact on Signal Strength: Studies with Ano9 knockout mice demonstrate reduced electro-olfactogram (EOG) responses and diminished neural activity in the olfactory bulb, suggesting that Ano9-mediated amplification is critical for normal olfactory function . This amplification mechanism likely enhances Olfr1019-mediated signals as well.

  • Potential Compensation Mechanisms: In Olfr1019 knockout mice, Ano9-mediated signal amplification might become especially important for amplifying signals from other, less sensitive TMT receptors, partially explaining the incomplete loss of TMT responses in these animals.

A comprehensive study comparing Olfr1019 single knockout, Ano9 single knockout, and Olfr1019/Ano9 double knockout mice would provide valuable insights into how these systems interact to produce robust olfactory-driven behaviors.

What are the critical controls needed when studying Olfr1019 function?

When studying Olfr1019 function, implementing robust controls is essential for reliable results:

Control TypePurposeImplementation
Genetic ControlsVerify knockout specificity1. Include heterozygous mice alongside homozygous knockouts and wild-type
2. Confirm normal expression of other olfactory receptors in Olfr1019 KO mice
3. Use RNA sequencing to verify no compensatory changes in other receptors
Behavioral ControlsEnsure specificity of behavioral responses1. Test responses to control odors that don't activate Olfr1019
2. Use anosmic mouse models as negative controls
3. Test responses to TMT at multiple concentrations
c-Fos Activation ControlsValidate specificity of neural activation1. Include no-odor exposure controls
2. Count c-Fos positive cells in non-olfactory brain regions as negative controls
3. Use positive control odorants known to activate distinct glomeruli
RT-PCR ControlsConfirm technical accuracy1. Include RT-negative mix without Superscript III
2. Use primers for housekeeping genes as positive controls
3. Test samples from tissues not expressing Olfr1019 as negative controls

Proper implementation of these controls ensures that observed phenotypes are specifically related to Olfr1019 function rather than experimental artifacts or compensatory mechanisms.

How can researchers troubleshoot inconsistent TMT-induced behavioral responses in Olfr1019 studies?

When encountering inconsistent TMT-induced behavioral responses in Olfr1019 studies, researchers should systematically address these methodological factors:

  • Odor Concentration Standardization: TMT concentration significantly impacts behavioral responses. Use precise dilution series and verify concentrations with gas chromatography-mass spectrometry. Document exact concentrations used, as different Olfr1019-expressing neurons may have different activation thresholds.

  • Environmental Factors: Control testing environment variables including:

    • Time of day (standardize testing to same circadian period)

    • Background odors (use HEPA-filtered air systems)

    • Noise levels (conduct tests in sound-attenuating chambers)

    • Temperature and humidity (maintain at consistent levels)

    • Previous odor exposures (clean apparatus thoroughly between trials)

  • Individual Variation Assessment: Account for sex, age, and strain differences:

    • Test balanced cohorts of male and female mice

    • Use age-matched animals (ideally 8-12 weeks old)

    • Consider background strain effects, especially if using mixed genetic backgrounds

  • Technical Validation: Confirm proper function of equipment:

    • Verify olfactory epithelium integrity with histology

    • Conduct EOG recordings to confirm olfactory sensitivity

    • Use positive control odors that elicit consistent responses

  • Habituation Effects: Pre-expose mice to the testing chamber without odor stimuli for several days before actual testing to minimize novelty effects and establish consistent baseline behavior.

Methodically addressing these factors increases reproducibility and reliability in Olfr1019 behavioral studies.

What are the key considerations when designing primers for Olfr1019 detection in RT-PCR?

Designing optimal primers for Olfr1019 detection requires careful consideration of several technical factors:

  • Specificity Considerations:

    • Olfactory receptor genes share sequence similarities, so conduct comprehensive BLAST analysis to ensure primers uniquely amplify Olfr1019

    • Design primers across exon-exon junctions when possible to prevent genomic DNA amplification

    • Include sequence regions that distinguish Olfr1019 from other closely related receptors in the same subfamily

    • Optimal primer length should be 18-25 nucleotides with 50-60% GC content

  • Technical Parameters:

    • Design primers with melting temperatures between 58-62°C with less than 2°C difference between forward and reverse primers

    • Avoid secondary structures and primer-dimer formation using tools like OligoAnalyzer

    • Position the amplicon to be 80-150 bp for optimal qPCR efficiency

    • Ensure the 3' end of primers contains C or G bases (GC clamp) for stronger annealing

  • Controls and Validation:

    • Test primers on wild-type and Olfr1019 knockout tissues to confirm specificity

    • Include no-RT controls to detect genomic DNA contamination

    • Sequence amplified products to verify correct target amplification

    • Test primer efficiency using standard curves with serial dilutions of template

  • Reference Gene Selection:

    • Include stable reference genes appropriate for olfactory tissue (e.g., GAPDH, β-actin, OMP)

    • Validate reference gene stability across experimental conditions

    • Use multiple reference genes for normalization to improve reliability

Adhering to these guidelines ensures sensitive and specific detection of Olfr1019 expression in diverse experimental contexts.

How might single-cell transcriptomics advance our understanding of Olfr1019-expressing neurons?

Single-cell transcriptomics offers transformative potential for understanding Olfr1019-expressing neurons through multiple advanced applications:

  • Developmental Trajectory Mapping: Single-cell RNA sequencing can track the developmental progression of Olfr1019-expressing neurons from precursors to mature olfactory sensory neurons. This approach would reveal transcriptional programs governing the selection and maintenance of Olfr1019 expression, providing insights into the "one receptor-one neuron" rule that governs olfactory receptor expression.

  • Co-expression Pattern Analysis: Single-cell approaches can identify genes consistently co-expressed with Olfr1019, potentially revealing:

    • Signal transduction components specifically enriched in Olfr1019 neurons

    • Transcription factors that regulate Olfr1019 expression

    • Axon guidance molecules that direct Olfr1019 neurons to specific glomeruli

    • Novel signaling molecules that coordinate with Olfr1019 activation

  • Receptor Sensitivity Variation Analysis: Even within the population of Olfr1019-expressing neurons, single-cell transcriptomics might reveal subpopulations with varying expression levels of signal amplification molecules like Anoctamin 9 (Ano9) , potentially explaining variability in TMT sensitivity.

  • Cross-Species Comparative Analysis: Apply single-cell approaches across multiple species to understand evolutionary conservation of Olfr1019 expression patterns and associated gene networks, providing insights into the fundamental principles of olfactory coding.

Single-cell transcriptomics thus provides an unprecedented opportunity to explore the molecular identity and heterogeneity of Olfr1019-expressing neurons within the complex landscape of the olfactory epithelium.

What alternative signaling pathways might interact with Olfr1019-mediated responses?

Several alternative signaling pathways may interact with Olfr1019-mediated responses, presenting opportunities for novel research directions:

  • Calcium-Independent Signaling: While canonical olfactory signaling involves cAMP-activated calcium influx through CNG channels, recent evidence suggests potential calcium-independent pathways. Investigating whether Olfr1019 activation can trigger defensive behaviors through non-canonical signaling would expand our understanding of olfactory coding.

  • Neuromodulation of Olfr1019 Signaling: Neuropeptides and neurotransmitters from centrifugal projections might modulate Olfr1019 sensitivity. These modulatory influences could explain context-dependent variations in TMT responses. For example, stress hormones might enhance Olfr1019 sensitivity during threatening situations.

  • Anoctamin 9 Interactions: The cation channel Anoctamin 9 (Ano9) is activated by the cAMP/PKA pathway and amplifies olfactory signals . Research exploring specific interactions between Olfr1019 activation and Ano9-mediated signal amplification could reveal how signal strength is modulated at the receptor level. Since Ano9 knockout mice show reduced olfactory sensitivity , combined Olfr1019/Ano9 studies might uncover cooperative mechanisms.

  • PKA-Mediated Phosphorylation: Investigating the phosphorylation status of Olfr1019 following activation could reveal how receptor sensitivity is dynamically regulated. This could be particularly important for understanding adaptation to persistent TMT exposure in ecologically relevant scenarios.

Exploring these alternative pathways would provide a more comprehensive understanding of how Olfr1019 activation is translated into defensive behaviors under varying environmental and physiological conditions.

How might comparative studies between different species inform our understanding of Olfr1019 evolution and function?

Comparative studies across species could significantly enhance our understanding of Olfr1019 evolution and function through several methodological approaches:

  • Phylogenetic Analysis of Receptor Conservation: Examining Olfr1019 orthologs across mammalian species would reveal evolutionary conservation patterns. Species with different predator pressures might show variations in receptor sensitivity or expression levels that correlate with ecological niches. Such analysis should include:

    • Sequence comparisons of binding domains

    • Analysis of promoter regions governing expression patterns

    • Identification of species-specific receptor modifications

  • Functional Conservation Testing: Heterologous expression of Olfr1019 orthologs from different species could determine whether:

    • Response profiles to TMT are conserved

    • Sensitivity thresholds vary according to predator exposure

    • Signal transduction coupling mechanisms are preserved

    This approach could follow methods similar to those used for testing other olfactory receptors like OR556 .

  • Comparative Signal Amplification Mechanisms: Given that birds' olfactory systems show different properties (e.g., chick ANO9 lacks the functional serine residue (Ser245) required for PKA-mediated activation ), comparing signal amplification mechanisms across species could reveal diverse evolutionary strategies for olfactory sensitivity tuning.

  • Behavioral Response Conservation: Cross-species behavioral testing with TMT could determine whether Olfr1019-like receptors consistently mediate defensive behaviors across varied taxonomic groups, providing insights into the evolutionary basis of innate responses to predator odors.

These comparative approaches would contextualize Olfr1019 function within an evolutionary framework, potentially revealing fundamental principles of olfactory coding conserved across diverse species.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.