Recombinant Mouse Olfactory receptor 1020 (Olfr1020)

Shipped with Ice Packs
In Stock

Description

Introduction to Mouse Olfactory Receptors

Olfactory receptors constitute the foundation of mammalian olfactory perception, enabling the recognition and discrimination of thousands of different odorant molecules. These G protein-coupled receptors (GPCRs) are expressed in olfactory sensory neurons (OSNs) within the olfactory epithelium. The molecular basis of OR-mediated signal detection and transduction remains incompletely understood due to significant challenges in functionally expressing these receptors in high yields, which has prevented extensive structural and biophysical studies at the protein level .

Mouse models have become essential tools for studying olfactory function, as they provide valuable insights into the molecular mechanisms underlying odor detection and discrimination. The mouse genome contains approximately 1,000 functional OR genes, each encoding a unique receptor protein with specific odorant-binding properties. These receptors typically follow the "one neuron-one receptor" rule, where each olfactory sensory neuron expresses only one type of OR, creating a precisely organized system for odor coding and processing.

Gene Structure and Chromosomal Location

The Olfr1020 gene, also known by its synonym MOR201-2, is located on chromosome 2 (forward strand) in the mouse genome, spanning positions 85689577 to 85690655, with a total length of 1079 base pairs . The gene is associated with several transcripts, including BC119147, NM_146580, and BC119145, suggesting possible alternative processing or expression patterns .

Challenges in Olfactory Receptor Expression

The production of recombinant olfactory receptors presents significant challenges for researchers. Like other membrane proteins, ORs are often difficult to express in functional forms due to issues such as improper folding, aggregation, and inefficient translocation to the plasma membrane. These challenges have historically limited structural and functional studies of ORs, including Olfr1020 .

Expression Systems for Recombinant Olfr1020

Various expression systems have been employed for the recombinant production of olfactory receptors, with varying degrees of success. For mouse olfactory receptors, mammalian cell expression systems have shown promising results. For instance, research on the mouse receptor mOR256-17 demonstrated successful expression yielding approximately 10^6 receptors per cell in transiently transfected mammalian cells . Similar approaches can be applied to Olfr1020.

The expression of Olfr1020 as a recombinant protein typically involves:

  1. Gene cloning into appropriate expression vectors

  2. Selection of suitable host cells (mammalian, insect, or microbial)

  3. Optimization of expression conditions

  4. Protein purification and characterization

Commercial recombinant Olfr1020 is available as a research tool, typically supplied in Tris-based buffer with 50% glycerol, optimized for stability, and recommended to be stored at -20°C or -80°C for extended preservation .

Promoter and Vector Selection for Optimal Expression

The choice of expression system significantly impacts the yield and functionality of recombinant proteins. For olfactory receptors, including Olfr1020, the selection of appropriate promoters and replication origins plays a crucial role in successful expression. Expression vectors with promoters of varying strengths (such as P T7, P trc, P tac, and P BAD) and different replication origins (high copy number pMB1' or low copy number p15A) can be used, depending on the specific requirements of the expression system .

Table 1: Comparison of Expression Systems for Recombinant Olfactory Receptors

Expression SystemHostAdvantagesDisadvantagesApplications for ORs
Mammalian cell linesHEK293, CHONative-like folding, post-translational modificationsHigher cost, lower yieldsFunctional studies, structural analysis
Insect cellsSf9, High FiveHigh expression levels, eukaryotic processingModerate cost, complex cultureReceptor trafficking studies
E. coliBL21(DE3), RosettaLow cost, high yieldsInclusion body formation, lack of post-translational modificationsProduction of receptor fragments
Cell-free systemsWheat germ, E. coli extractsRapid expression, membrane mimeticsLimited scale, higher costPreliminary binding studies

Methodologies for Studying Olfr1020 Function

Several approaches have been developed to identify and characterize olfactory receptor responses to odorants. One such method is the Kentucky in vivo odorant ligand-receptor assay, which facilitates the identification of mouse ORs for specific odorant ligands of interest . This technique involves exposing mice to filtered air followed by intermittent odor exposure over a defined period, allowing for the development of GFP fluorescence in responsive OSNs .

For recombinant Olfr1020 specifically, functional characterization often employs:

  1. Fluorescent labeling techniques to monitor expression and localization

  2. Cell-based assays measuring second messenger responses (e.g., calcium imaging)

  3. Ligand-binding studies to identify potential odorants

  4. Comparative analyses with other olfactory receptors

Visualization and Quantification Techniques

Quantification and optimization of OR expression can employ different fluorescent probes. For instance, green fluorescent protein (GFP) fused to the C-terminus of olfactory receptors allows quantification of total cellular OR biosynthesis. Additionally, post-translational fluorescence labeling of a specific amino acid sequence at the N-terminus permits the selective visualization and quantification of ORs at the plasma membrane using cell flow cytometry . Such dual-color labeling approaches are generally applicable to the quantification of membrane proteins in mammalian cell-based expression systems and could be applied to Olfr1020 studies.

Role in Olfactory Research

Recombinant Olfr1020 serves as a valuable tool in olfactory research, enabling studies on:

  1. Structure-function relationships in olfactory receptors

  2. Molecular mechanisms of odorant recognition

  3. Signal transduction pathways in olfactory sensory neurons

  4. Comparative analyses of olfactory receptor properties across species

The availability of recombinant Olfr1020 facilitates investigations into its specific odorant binding profile and signaling characteristics, contributing to our understanding of how the olfactory system encodes and discriminates different odors.

Technological Applications

Beyond basic research, recombinant olfactory receptors like Olfr1020 have potential applications in:

  1. Development of biosensors for specific odorant detection

  2. Design of novel fragrances and flavoring compounds

  3. Medical diagnostics based on olfactory receptor responses

  4. Environmental monitoring for specific volatile compounds

Future Research Directions

Future studies on recombinant Olfr1020 may focus on:

  1. Identifying its specific odorant ligands through large-scale screening approaches

  2. Determining its three-dimensional structure through advanced crystallography or cryo-EM techniques

  3. Investigating its interaction partners in the signal transduction cascade

  4. Developing improved expression systems for higher yields of functional receptor

  5. Exploring its evolutionary relationships with other olfactory receptors

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your desired format in the order notes and we will fulfill your requirements.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. For dry ice shipping, please contact us in advance as additional fees may apply.
Notes
Repeated freeze-thaw cycles are not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
Prior to opening, we suggest centrifuging the vial briefly to concentrate the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by factors including storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize its development.
Synonyms
Olfr1020; Mor201-2; Olfactory receptor 1020; Olfactory receptor 201-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Olfr1020
Target Protein Sequence
MVRSGKGIQNKNATEVTEFILLGLSDNPDLQGVLFALFLIIYTMTLVGNLGMMALIKIDR SLHTPMYFFLSSLSFVDASYSSSVTPKMLVNLMAEDKSISFNGCATQFFFFGSFLGTECF LLAMMAYDRYAAIWNPLLYPVLMSGRICFMLVSTSFLAGFGNAAIHTGMTFRLSFCGSNK INHFYCDTPPLLKLSCSDTHINGIVIMAFSSFNVISCVLIVLISYLCILIAILKMPSAEG RHKAFSTCASHLMAVTIFFGTILFMYLRPTSSYSMEQDKVVSVFYTVVIPMLNPLIYSLK NKDVKKAVKKILHNYVV
Uniprot No.

Target Background

Function
Potential odorant receptor.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and classification of mouse Olfr1020?

Mouse Olfr1020 belongs to the largest family of sensory membrane proteins in mammals - the olfactory receptors. Like other ORs, it is a G protein-coupled receptor with seven transmembrane domains that plays a crucial role in recognizing and discriminating odorous molecules . The receptor contains the characteristic structural features of class A GPCRs, including conserved residues in transmembrane domains that are critical for proper protein folding and function. Structurally, Olfr1020 shares the common architecture of olfactory receptors with extracellular loops that form the ligand-binding pocket, intracellular loops that interact with signaling proteins, and transmembrane domains that anchor the receptor in the cell membrane.

How does Olfr1020 expression compare to other mouse olfactory receptors?

Like other mammalian olfactory receptors, Olfr1020 follows the canonical "one receptor per neuron" rule, which differs significantly from what has been observed in other species such as mosquitoes, where multiple chemosensory receptors can be co-expressed within individual olfactory sensory neurons (OSNs) . Expression levels of olfactory receptors in mice typically range from a few transcript copies per million (TPM) to higher values in mature olfactory sensory neurons . The expression of Olfr1020, like other ORs, is regulated by complex transcriptional mechanisms involving multiple transcription factors that ensure appropriate spatiotemporal expression patterns .

What are the current methodologies for studying Olfr1020 function?

Several complementary approaches can be applied to study Olfr1020 function:

  • Recombinant expression systems: Transfection of mammalian cells (e.g., HEK293) to express Olfr1020, often with fluorescent tags for visualization and quantification .

  • Calcium imaging assays: Monitoring intracellular calcium levels in response to potential ligands to identify odorants that activate Olfr1020.

  • In vivo identification methods: Using genetically modified mice (e.g., with S100a5-tauGFP) to isolate Olfr1020-expressing neurons after odorant exposure .

  • Electrophysiological recordings: Patch-clamp or extracellular recordings to measure neuronal responses to odorants.

  • Molecular docking and computational modeling: Predicting ligand-receptor interactions based on structural models.

Each method offers different advantages, and combining multiple approaches provides the most comprehensive understanding of receptor function.

What are the optimal conditions for recombinant expression of functional Olfr1020?

Recombinant expression of olfactory receptors, including Olfr1020, presents significant challenges due to their poor trafficking to the plasma membrane in heterologous systems. Based on successful protocols for other mouse ORs, the following optimization strategies are recommended:

  • Expression vector selection: Use mammalian expression vectors with strong promoters (e.g., CMV) and appropriate trafficking signal sequences.

  • Cell line selection: HEK293T cells have shown superior results compared to other cell lines for mouse OR expression .

  • N-terminal modification: Addition of the first 20 amino acids of rhodopsin or other signal sequences can enhance surface expression .

  • Co-expression with accessory proteins: Co-transfection with RTP1S, RTP2, REEP1, and Ric8b can significantly improve trafficking to the plasma membrane.

  • Temperature modulation: Incubation at 33°C instead of 37°C for 24-48 hours post-transfection can increase functional expression.

  • Quantification methods: Dual-color labeling approach with GFP fusion at the C-terminus for total protein expression and N-terminal epitope tags for surface expression quantification .

Optimal yields for mouse ORs using these methods can reach approximately 10^6 receptors per cell in transiently transfected mammalian cells .

How can researchers identify specific ligands for Olfr1020?

Identifying ligands for olfactory receptors requires systematic screening approaches. For Olfr1020, consider the following methodological framework:

  • High-throughput screening: Test a diverse library of odorant compounds (100-500 molecules) at multiple concentrations.

  • Structure-based virtual screening: Use homology models of Olfr1020 to computationally predict potential ligands.

  • Kentucky in vivo odorant ligand-receptor assay: This approach involves:

    • Using S100a5-tauGFP mice that express GFP in mature OSNs

    • Exposing mice to candidate odorants

    • Isolating GFP-positive neurons via FACS

    • Comparing OR mRNA abundance between GFP-positive and GFP-negative populations

  • Dose-response characterization: Once candidate ligands are identified, establish full dose-response curves to determine EC50 values.

  • Structure-activity relationship analysis: Test structural analogs of active compounds to define the molecular features required for receptor activation.

Assay TypeThroughputPhysiological RelevanceTechnical ComplexityResource Requirements
Heterologous cell-basedHighLow-MediumMediumMedium
Kentucky in vivo assayLowHighHighHigh
Computational screeningVery HighLowMediumLow
ElectrophysiologyVery LowHighVery HighHigh

What transcription factors regulate Olfr1020 expression in olfactory sensory neurons?

The regulation of olfactory receptor expression involves a complex network of transcription factors. Based on studies of other mouse ORs, several transcription factors likely play roles in regulating Olfr1020:

  • Lhx2 (LIM homeobox protein 2): A critical factor for initiating OR gene expression during development.

  • Emx2 (Empty spiracles homeobox 2): Influences the probability of OR gene choice.

  • Ebf1 (Early B cell factor 1): Required for olfactory neuron maturation and OR expression.

  • ATF5 (Activating transcription factor 5): Involved in the feedback mechanism that ensures singular OR expression.

  • Unpg (Unplugged/Gbx2): May be required for OR expression in specific ORN types, as demonstrated for several other ORs .

Single-cell RNA sequencing has revealed that OSNs express approximately 150 transcription factors on average . The specific combination of these factors likely determines the expression pattern of Olfr1020, though direct experimental validation for this specific receptor is still needed.

What are the most effective strategies for quantifying Olfr1020 expression levels?

Accurate quantification of Olfr1020 expression requires complementary approaches targeting both transcript and protein levels:

mRNA Quantification:

  • Quantitative RT-PCR: Design primers specific to Olfr1020, avoiding cross-reactivity with other highly homologous ORs.

  • Digital droplet PCR: Provides absolute quantification of transcript copies, particularly useful for low-abundance transcripts.

  • RNA-Seq/Single-cell RNA-Seq: Enables transcriptome-wide analysis and comparison of Olfr1020 with other ORs .

Protein Quantification:

  • Fluorescent fusion proteins: C-terminal GFP fusion allows visualization and quantification of total receptor expression .

  • Surface labeling: N-terminal epitope tags or bioluminescence resonance energy transfer (BRET) approaches can quantify membrane-localized receptors .

  • Flow cytometry: Enables high-throughput analysis of receptor expression at the single-cell level .

  • Western blotting: For bulk quantification, though antibody specificity can be challenging.

A dual-color labeling approach combining C-terminal GFP fusion (total expression) with N-terminal epitope tag labeling (surface expression) provides the most comprehensive quantification of receptor trafficking efficiency .

How can researchers optimize functional assays for Olfr1020 ligand screening?

Functional assays for olfactory receptors require careful optimization to achieve reliable results. For Olfr1020, consider the following methodological refinements:

  • Cell-based assay optimization:

    • Ensure consistent transfection efficiency (>70%) using appropriate controls

    • Include positive controls (receptors with known ligands) and negative controls (mock-transfected cells)

    • Optimize cell density and assay timing post-transfection (typically 24-48 hours)

    • Standardize assay conditions including buffer composition, temperature, and plate materials

  • Signal detection optimization:

    • For calcium imaging: optimize dye loading time, concentration, and wavelength settings

    • For cAMP assays: determine the optimal stimulation time and cAMP detection method

    • For BRET/FRET-based assays: optimize donor/acceptor ratios and measurement windows

  • Compound handling protocols:

    • Test multiple concentrations spanning at least 4 log units (e.g., 1 nM to 10 μM)

    • Prepare fresh odorant dilutions for each experiment

    • Use appropriate vehicle controls (typically ≤0.1% DMSO)

    • Account for volatility and potential degradation of odorant compounds

  • Data analysis considerations:

    • Apply appropriate normalization methods (percent of maximum response or fold over baseline)

    • Use curve-fitting algorithms that account for potential partial agonism

    • Implement statistical thresholds for positive hit identification (typically >3 SD above baseline)

What are the contemporary approaches for validating Olfr1020 ligand specificity?

Establishing true ligand specificity requires multiple lines of evidence:

  • Comparative pharmacology: Test identified ligands against closely related olfactory receptors to establish selectivity profiles.

  • Structure-activity relationship (SAR) studies: Systematically modify chemical structures to identify molecular determinants of activity.

  • Mutation analysis: Introduce point mutations in predicted binding pocket residues to validate ligand-receptor interaction models.

  • Competitive binding assays: Determine if multiple ligands compete for the same binding site.

  • In vivo validation: Confirm findings from in vitro systems using the Kentucky in vivo odorant ligand-receptor assay or similar approaches .

  • Cross-species comparison: Test if orthologs of Olfr1020 in other species respond similarly to identified ligands.

  • Knockout/knockin studies: Generate mice lacking Olfr1020 or replace it with a reporter to confirm the physiological relevance of identified ligands.

What are the common pitfalls in recombinant expression of Olfr1020 and how can they be addressed?

Recombinant expression of olfactory receptors faces several technical challenges:

  • Poor membrane trafficking:

    • Problem: Most ORs, likely including Olfr1020, show retention in the endoplasmic reticulum.

    • Solution: Use specialized accessory proteins (RTPs, REEPs) and N-terminal signal sequences to enhance surface expression .

  • Receptor misfolding:

    • Problem: Heterologous systems may not provide appropriate chaperones for proper folding.

    • Solution: Reduce expression temperature to 33°C and add chemical chaperones such as DMSO (1-2%) or glycerol (10%) to the culture medium.

  • Low functional response:

    • Problem: Even surface-expressed receptors may not signal efficiently.

    • Solution: Co-express with optimized G protein subunits or chimeric G proteins tailored to the detection system.

  • Variable expression between experiments:

    • Problem: Day-to-day variability in transfection efficiency and expression levels.

    • Solution: Develop stable cell lines or use standardized transfection protocols with internal standards for normalization.

  • Ligand volatility and solubility issues:

    • Problem: Odorants are often volatile and poorly water-soluble.

    • Solution: Use sealed plates, minimize freeze-thaw cycles, and prepare fresh dilutions for each experiment.

How can researchers address experimental variability in Olfr1020 functional studies?

Variability in olfactory receptor functional studies can significantly impact reproducibility. Implement these strategies to minimize experimental noise:

  • Standardize expression systems:

    • Use the same cell line, passage number, and culture conditions across experiments

    • Quantify receptor expression levels in each batch of experiments

    • Perform transfections in larger batches and cryopreserve aliquots when possible

  • Implement robust controls:

    • Include positive control receptors with known ligands in each experiment

    • Use multiple negative controls (untransfected, mock-transfected, and unrelated receptor)

    • Include technical replicates (minimum n=3) for each condition

  • Optimize assay parameters:

    • Determine the optimal time window for measurements after ligand addition

    • Establish consistent baseline periods before stimulation

    • Account for potential desensitization in repeated measures

  • Data normalization strategies:

    • Normalize to internal standards rather than using absolute values

    • Consider using area under the curve rather than peak amplitude for response quantification

    • Apply appropriate statistical tests for non-normally distributed data

  • Compound management:

    • Establish quality control protocols for odorant compounds

    • Document storage conditions and age of all reagents

    • Test multiple independent preparations of critical compounds

What are the emerging technologies that might advance Olfr1020 research?

Several cutting-edge technologies show promise for advancing olfactory receptor research, including studies on Olfr1020:

  • Cryo-electron microscopy (Cryo-EM): May enable structural determination of olfactory receptors, including Olfr1020, in native-like environments without requiring crystallization.

  • Nanobody development: Generating specific nanobodies against Olfr1020 could stabilize the receptor for structural studies and provide tools for tracking receptor localization.

  • Advanced genomic engineering:

    • CRISPR-Cas9 gene editing for precise receptor tagging in vivo

    • Split-QF2 system for investigating co-expression patterns, as demonstrated in mosquito ORNs

  • Microfluidic organ-on-chip models: Recreating the olfactory epithelium microenvironment for more physiologically relevant functional studies.

  • AI-powered computational models: Machine learning approaches for predicting olfactory receptor-ligand interactions based on limited experimental data.

  • Single-molecule imaging techniques: Real-time visualization of receptor dynamics and trafficking in live cells.

  • Spatial transcriptomics: Mapping the precise location of Olfr1020 expression within the olfactory epithelium in relation to other cell types and receptors.

What are the most promising research directions for advancing Olfr1020 understanding?

The field of olfactory receptor research continues to evolve rapidly, with several promising avenues for future Olfr1020 investigations:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.