Recombinant Mouse Olfactory receptor 1030 (Olfr1030)

Shipped with Ice Packs
In Stock

Description

Table 1: Olfr1030 Protein Overview

PropertyDetail
Gene NameOlfr1030 (Mor196-2)
UniProt IDQ8VFL5
SpeciesMus musculus (Mouse)
Sequence Length318 amino acids
Expression Region1-318 (full-length)
Key DomainsTransmembrane helices, ligand-binding pocket, intracellular loops

Odorant Detection and Signaling

  • Olfr1030 detects specific odorant molecules, activating cAMP-mediated signaling pathways upon ligand binding .

  • Like other olfactory receptors, it regulates axon guidance by modulating transcription of axon-sorting molecules .

Genetic and Post-Transcriptional Regulation

  • Strain-Specific Expression:

    • Transcript levels of Olfr1030 differ between mouse strains (e.g., B6 vs. 129), suggesting genetic modifiers influence its expression .

  • Post-Transcriptional Features:

    • Olfr1030 mRNA exhibits high AU-content (≈70%) and shorter 3' UTRs compared to non-olfactory mRNAs, enhancing translational efficiency .

    • Contains upstream open reading frames (uORFs) in the 5' UTR, potentially regulating protein synthesis under stress .

Research Tools and Applications

Recombinant Olfr1030 is commercially available for experimental use:

  • ELISA Kits:

    • Sold by vendors like e-scapebio and Biotrend, with specifications including Tris-based storage buffers and 50% glycerol for stability .

  • Applications:

    • Ligand specificity assays.

    • Studies on odorant-induced neuronal plasticity .

Orthologs and Comparative Genomics

Olfr1030 has orthologs in rats (Olr470) but no direct human counterpart. Cross-species comparisons highlight evolutionary divergence in olfactory receptor repertoires .

Table 3: Ortholog Comparison

SpeciesGene IDProtein Name
MouseOlfr1030Olfactory receptor 1030
RatOlr470Olfactory receptor 470
HumanN/ANo direct ortholog identified

Research Gaps and Future Directions

  • Ligand Specificity: No published data directly identify Olfr1030’s odorant ligands.

  • In Vivo Function: Its role in odor-guided behaviors remains uncharacterized.

  • Regulatory Mechanisms: How genetic background modulates its expression requires further study .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Olfr1030; Mor196-2; Olfactory receptor 1030; Olfactory receptor 196-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-318
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Olfr1030
Target Protein Sequence
MLAPKKMVRGNYSMVTEFILLGLTDRPELQPLLFVLFLVIYLITVGGNLGMMVLIRIDSR LHTPMYYFLASLSCLDLCYSTNVTPKMLVNFLSEKKTISYAACLVQCYFFIAMVITEYYM LAVMAYDRYMAICNPLLYSSKMSKGVCVRLIAGPYIYGFLSGLMETMWTYRLTFCGSNII NHFYCADPPLIRLSCSDTFIKETSMFVVAGFNLSNSLFIILISYLFILIAILRMRSAEGR RKAFSTCGSHLVAVTVFYGTLFCMYVRPPTDKSVEQSKIIAVFYTFVSPMLNPIIYSLRN KDVKHAFWKLVRRNVLSK
Uniprot No.

Target Background

Function
Potential odorant receptor.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Olfr1030 and how is it classified within the mouse olfactory receptor family?

Olfr1030 is one of approximately 1100 olfactory receptor (OR) genes in the mouse genome encoding G-protein-coupled receptors (GPCRs) that function in odor detection. Mouse ORs are phylogenetically categorized into two classes: Class I receptors, which have counterparts throughout the vertebrate lineage, and Class II receptors, which are tetrapod-specific . Proper classification requires sequence analysis to determine evolutionary relationships with other ORs. Like other ORs, Olfr1030 would be expressed in olfactory sensory neurons (OSNs) in the main olfactory epithelium (MOE), where it participates in the initial recognition of volatile odorants.

What are the expression patterns of Olfr1030 in the olfactory epithelium?

Olfr1030, like other mouse olfactory receptors, follows a monogenic and monoallelic expression pattern, meaning each mature olfactory sensory neuron (OSN) expresses only one allele of a single OR gene . This singular expression depends on complex genomic organization involving heterochromatic chromatin domains that sequester OR gene clusters . To visualize Olfr1030 expression patterns, researchers typically employ techniques similar to those used for other ORs, such as developing transgenic mouse lines with fluorescent reporters (e.g., IRES-GFP or IRES-tauGFP constructs) inserted downstream of the Olfr1030 coding sequence . This approach allows for tracking OSNs expressing this specific receptor and mapping their projections to glomeruli in the olfactory bulb.

How does the promoter architecture of Olfr1030 compare to other mouse olfactory receptors?

The promoter architecture of Olfr1030 would share characteristics with other mouse OR genes. Transcription start sites (TSSs) and promoters of OR genes have been mapped using technologies such as nanoCAGE, which has revealed the architecture for approximately 87.5% of mouse OR genes . OR promoters typically contain binding sites for specific transcription factors including TBP, EBF1 (also known as OLF1), and MEF2A, which have been confirmed to bind to OR promoters through chromatin immunoprecipitation . For detailed characterization of the Olfr1030 promoter, researchers should examine the genomic region flanking its major TSS, as short genomic fragments (similar to those identified for Olfr160/M72) can often drive OSN-specific expression in transgenic mice .

What are the optimal heterologous expression systems for functional characterization of Olfr1030?

For functional characterization of Olfr1030, researchers have multiple heterologous expression options, each with distinct advantages and limitations:

  • Ex vivo cilia preparation approach: This system allows for proper OR localization to the ciliary plasma membrane and natural G-protein coupling environment. Comparing responses in wild-type cilia versus cilia from transgenic mice overexpressing the receptor enables quantification of odorant response properties with high sensitivity. This approach has demonstrated 40-100 fold better sensitivity for some ORs compared to other assays, detecting responses at nanomolar concentrations for high-affinity ligands .

  • Caenorhabditis elegans expression system: This alternative approach requires careful construct design, including: (i) coding regions cloned into C. elegans-specific expression vectors, or (ii) synthetically constructed DNA containing the promoter region, coding region, and 3'-UTR of Olfr1030 . Success with this system depends on optimizing microinjection techniques and construct design.

When comparing these systems, the ex vivo cilia preparation offers several advantages for Olfr1030 research:

Expression SystemAdvantagesDisadvantagesSensitivity
Ex vivo cilia preparation- Native signaling components
- Proper membrane localization
- Evaluates all OR functions (binding, neuronal maturation, axon guidance)
- Scalable for high-throughput analysis
- Requires transgenic mice generation
- More technically demanding
EC50 values in nanomolar range (0.29μM for OR5AN1, significantly lower than other systems)
Heterologous cell systems (e.g., HEK293)- Simpler implementation
- No animal models required
- Faster screening
- Sometimes fails with ORs resistant to functional expression
- Limited assessment of neuronal functions
- Less sensitive
EC50 values typically in micromolar range (12.5-32.1μM for some ORs)
C. elegans expression- Whole organism assessment
- Behavioral outputs possible
- Requires species-specific vectors
- Further from native environment
Variable, less characterized for ORs

How can researchers accurately assess ligand specificity and sensitivity for Olfr1030?

Accurate assessment of Olfr1030 ligand specificity and sensitivity requires robust methodological approaches. Based on established protocols for other ORs, researchers should:

  • Isolated cilia preparation: Develop a transgenic mouse line overexpressing Olfr1030 and extract cilia using modified deciliation protocols. Confirm the presence of signaling components (Golf, ACIII) in isolated cilia preparations through Western blotting .

  • cAMP assay calibration: For ligand activation measurements, implement normalization procedures to account for baseline variations:

    • For typical odorants: Calculate normalized activity as [(Ligand-DMSO)/DMSO]TG / [(Ligand-DMSO)/DMSO]WT

    • For inhibitory compounds (e.g., musk compounds): Use the formula [(Ligand-DMSO)/DMSO]TG + 1 - (mean of [(Ligand-DMSO)/DMSO]WT)

  • Statistical analysis: Define successful responses as statistically significant increases (p<0.05) in the transgenic samples compared to non-transgenic controls. Perform a minimum of 3 technical replicates and 3-5 biological replicates to ensure reproducibility .

  • Evaluation parameters: Quantify OR performance using six key parameters:

    • Sensitivity (threshold concentration for detection)

    • Selectivity (response pattern across diverse odorants)

    • Stability (consistency of response across experimental conditions)

    • Signal-to-noise ratio

    • Response dynamics

    • Reproducibility across biological replicates

For dose-response curves, test multiple concentration points to accurately determine EC50 values, which can reveal high-affinity interactions in the nanomolar range that might be missed in less sensitive assays.

What role do transcription factors play in regulating Olfr1030 expression and how can this be experimentally verified?

Transcription factors play critical roles in the singular expression pattern of olfactory receptors, including Olfr1030. Research shows that:

  • Key transcription factors: Lhx2 and Ebf (OLF1) are essential for OR gene expression, binding to stereotypically spaced motifs within OR enhancers that evade heterochromatic silencing . These factors specify OR enhancers through functionally cooperative binding.

  • Enhancer hub formation: Intergenic transcriptional enhancers converge into interchromosomal hubs that assemble over the transcriptionally active OR gene, facilitating singular OR choice .

To experimentally verify the role of these transcription factors in Olfr1030 expression:

  • Chromatin immunoprecipitation (ChIP): Perform ChIP assays to confirm binding of TBP, EBF1, and MEF2A to the Olfr1030 promoter region, as demonstrated for other OR genes .

  • Transcription factor displacement: Implement targeted displacement of Lhx2 and Ebf from OR enhancers to observe effects on Olfr1030 expression. Previous studies have shown that such displacement results in pervasive, long-range, and trans-downregulation of OR transcription .

  • Multi-enhancer hub assembly: Test whether pre-assembly of a multi-enhancer hub increases the frequency of Olfr1030 choice in cis, as demonstrated for other ORs .

  • Conditional knockout experiments: Generate conditional knockout models (e.g., using Cre-Lox system) to delete Lhx2 specifically in mature OSNs, similar to previous studies that have established the role of transcription factors in OR expression .

This experimental approach provides genetic evidence for the requirement and sufficiency of interchromosomal interactions in the singular choice of Olfr1030 among the entire OR repertoire.

How can researchers generate and validate transgenic mouse models for studying Olfr1030?

To generate effective transgenic mouse models for studying Olfr1030, researchers should follow a systematic approach based on established protocols for other OR genes:

  • Construct design: Create a transgenic construct containing:

    • The full Olfr1030 coding sequence

    • An IRES (Internal Ribosome Entry Site) element

    • A fluorescent reporter gene (e.g., GFP, MyrPalm-GCaMP6f)

    For optimal visualization of neuronal structures, consider using membrane-targeted reporters like MyrPalm-GCaMP6f, which robustly labels axon membranes as they project to olfactory bulbs and form glomeruli .

  • Transgenic line production: Generate transgenic lines using either:

    • Gene targeting to replace the endogenous Olfr1030 locus

    • Transgenic overexpression under control of OR gene choice mechanisms

    The transgenic overexpression approach typically yields more OSNs expressing the transgene compared to gene-targeted approaches, as observed with OR5AN1 and OR1A1 lines .

  • Validation methods:

    • Wholemount analysis: Examine the epithelium and glomerular projections to confirm expression and proper targeting

    • En face imaging: Verify fluorescent labeling of ciliary membranes, which is crucial for functional studies

    • Western blotting: Confirm presence of signaling components (Golf, ACIII) in isolated cilia preparations

    • FACS sorting: Use fluorescence-activated cell sorting to isolate Olfr1030-expressing neurons for further molecular characterization, following protocols established for other OR-reporter lines

  • Functional assessment: Evaluate all three required functions of the OR:

    • Odorant binding

    • Promotion of neuronal maturation

    • Proper axon guidance

    All three functions must be retained for an OR to be considered fully functional. This comprehensive assessment distinguishes between truly functional ORs and intact pseudogenes or non-functional genes .

What are the most effective methods for isolating and analyzing Olfr1030-expressing olfactory sensory neurons?

For effective isolation and analysis of Olfr1030-expressing OSNs, researchers should implement a multi-faceted approach:

  • Transgenic reporter mouse generation: Develop Olfr1030-IRES-GFP or Olfr1030-IRES-tauGFP mouse lines following established protocols for other OR genes such as Olfr17, Olfr151, and Olfr1507 . These reporter constructs allow visualization and isolation of specific OSN populations.

  • Cell isolation techniques:

    • Fluorescence-activated cell sorting (FACS): Sort GFP-positive cells from dissociated olfactory epithelium of transgenic mice, as previously demonstrated for other OR-expressing neurons .

    • Laser capture microdissection: For spatial context preservation, isolate Olfr1030-expressing cells directly from tissue sections.

  • Single-cell analysis: Implement single-cell RNA sequencing to:

    • Confirm monogenic and monoallelic expression patterns

    • Identify co-expressed genes that may be involved in Olfr1030 signaling

    • Compare transcriptional profiles with other OR-expressing neurons

    This approach aligns with findings that human single-cell sequencing has identified approximately 140 out of ~400 ORs with high expression levels in mature OSNs .

  • Functional characterization:

    • Calcium imaging: For live-cell functional analysis, use calcium indicators (e.g., GCaMP6f) to measure neuronal responses to potential ligands.

    • Cilia isolation: Extract cilia from Olfr1030-expressing neurons using modified deciliation protocols to preserve the functional signaling components .

    • cAMP assays: Measure cAMP production in response to odorant stimulation, applying appropriate normalization procedures to account for baseline variations .

Each method should include appropriate controls, such as comparisons with wild-type tissues or OSNs expressing other well-characterized ORs.

How can researchers assess contradictions in Olfr1030 functional data using structured evaluation methods?

When encountering contradictory data in Olfr1030 research, structured evaluation methods are essential for robust scientific assessment. Implementing a contradiction pattern analysis approach:

  • Define contradiction parameters (α, β, θ):

    • α: Number of interdependent data items being compared (e.g., expression levels, ligand responses, signaling pathway activation)

    • β: Number of contradictory dependencies identified by domain experts

    • θ: Minimal number of Boolean rules required to assess these contradictions

  • Apply structured contradiction analysis:

    • For simple binary contradictions between two data items (2,1,1 class), use standard validation tools

    • For complex multidimensional contradictions involving multiple interdependent factors, implement more sophisticated analysis frameworks

  • Data quality assessment implementation:

    • Compare results across different experimental systems (e.g., heterologous cells vs. ex vivo cilia)

    • Evaluate potential biological explanations for apparent contradictions (e.g., OR polymorphisms, post-translational modifications)

    • Assess methodological differences that might explain divergent results (e.g., expression level variations, assay sensitivity)

  • Standardized reporting format:

    • Document all potential contradictions using the (α, β, θ) notation

    • Apply Boolean minimization techniques to reduce complex contradiction patterns to their minimal logical form

    • Present contradiction analyses alongside experimental data in standardized formats

Contradiction TypeExample in Olfr1030 ResearchAnalysis Approach
Simple (2,1,1)Contradictory ligand responses between two assay typesDirect comparison with statistical testing
Complex (n,m,k) where k<<mMultiple contradictory findings across diverse expression systemsBoolean minimization to identify core inconsistencies
Temporal contradictionsChanges in receptor sensitivity over experimental timeframesTime-series analysis with control comparisons

This structured approach to contradiction analysis "helps to handle the complexity of multidimensional interdependencies within health data sets" and can be effectively applied to Olfr1030 research data .

What statistical approaches are most appropriate for analyzing dose-response data for Olfr1030?

For robust analysis of Olfr1030 dose-response data, researchers should implement a comprehensive statistical framework:

  • Activation value calculation:

    • Define activation as the differential fold change of odor stimulation over solvent stimulation

    • Calculate normalized responses using the formula: [(Ligand-DMSO)/DMSO]TG / [(Ligand-DMSO)/DMSO]WT

    • For potentially inhibitory compounds, apply the correction formula: [(Ligand-DMSO)/DMSO]TG + 1 - (mean of [(Ligand-DMSO)/DMSO]WT)

  • Significance testing:

    • Define successful responses as statistically significant (p<0.05) increases in bioextracts expressing Olfr1030 compared to non-transgenic controls

    • Implement appropriate statistical tests (e.g., paired t-tests for before/after comparisons, ANOVA for multiple concentration comparisons)

    • Perform a minimum of 3 technical replicates and 3-5 biological replicates

  • Dose-response curve modeling:

    • Fit data to sigmoidal dose-response curves using nonlinear regression

    • Calculate EC50 values (concentration producing 50% of maximal response)

    • Determine confidence intervals for EC50 and Hill coefficients

    • Compare curve parameters across experimental conditions and with reference ORs

  • Comparative analysis framework:

    • Implement S3I and R2 analysis for activation calculations

    • Compare Olfr1030 response profiles with well-characterized ORs (e.g., OR5AN1, OR1A1)

    • Evaluate six key parameters: Sensitivity, Selectivity, Stability, Signal-to-noise ratio, Response dynamics, and Reproducibility

This statistical framework ensures appropriate quantification of Olfr1030 responses while facilitating comparisons with other ORs in the scientific literature.

How do genomic and epigenetic factors influence Olfr1030 expression, and how can these be experimentally investigated?

Genomic and epigenetic regulation of Olfr1030 expression involves complex mechanisms that can be investigated through several experimental approaches:

  • Chromatin organization analysis:

    • Investigate how Olfr1030 is incorporated into heterochromatic chromatin domains that sequester OR gene clusters

    • Analyze how intergenic transcriptional enhancers evade heterochromatic silencing and converge into interchromosomal hubs over active Olfr1030 loci

    • Apply chromosome conformation capture techniques (3C, 4C, Hi-C) to map three-dimensional chromatin interactions involved in Olfr1030 regulation

  • Transcription factor binding studies:

    • Perform chromatin immunoprecipitation (ChIP) to identify binding of known OR regulators (TBP, EBF1/OLF1, MEF2A) to the Olfr1030 promoter and enhancers

    • Analyze cooperative binding patterns of Lhx2 and Ebf to stereotypically spaced motifs within OR enhancers that influence Olfr1030 expression

    • Implement ChIP-seq to generate genome-wide binding profiles of relevant transcription factors

  • Enhancer characterization:

    • Identify enhancer elements affecting Olfr1030 expression through reporter assays

    • Test whether pre-assembly of a multi-enhancer hub increases the frequency of Olfr1030 choice in cis

    • Analyze the effects of targeted displacement of regulatory transcription factors from enhancers, which can result in pervasive downregulation of OR transcription

  • Promoter architecture analysis:

    • Apply nanoCAGE technology to precisely map the transcription start sites and promoter architecture of Olfr1030, as has been done for 87.5% of mouse OR genes

    • Test whether short genomic fragments flanking the major TSS of Olfr1030 can drive OSN-specific expression in transgenic mice, similar to what has been demonstrated for Olfr160 (M72)

    • Characterize non-coding RNAs, including antisense transcripts, that may influence Olfr1030 expression

These approaches provide a comprehensive framework for understanding the genomic and epigenetic factors controlling the singular expression pattern of Olfr1030 in olfactory sensory neurons.

How can researchers integrate Olfr1030 functional data with broader olfactory system studies?

Integrating Olfr1030 functional data with broader olfactory system studies requires a systematic approach that connects molecular mechanisms to physiological outcomes:

  • Glomerular mapping and neural circuit analysis:

    • Generate Olfr1030-IRES-tauGFP mice to visualize axonal projections to specific glomeruli in the olfactory bulb

    • Apply whole-brain imaging techniques to trace connections from Olfr1030-responsive glomeruli to higher brain centers

    • Use optogenetic or chemogenetic approaches to selectively activate Olfr1030-expressing neurons and monitor downstream circuit responses

  • Comparative receptor profiling:

    • Position Olfr1030 within the phylogenetic framework of Class I and Class II olfactory receptors

    • Compare functional properties of Olfr1030 with other ORs to identify patterns in ligand recognition and signaling efficiency

    • Construct a receptor-ligand interaction matrix to identify shared and unique response properties

  • Systems-level data integration:

    • Correlate Olfr1030 activation patterns with behavioral responses to corresponding odorants

    • Develop computational models that incorporate Olfr1030 response properties into odor coding simulations

    • Apply machine learning approaches to predict novel ligands based on structural similarities with known Olfr1030 activators

  • Translational research applications:

    • Investigate potential human orthologs of Olfr1030 and compare functional properties

    • Explore how Olfr1030 research findings might inform understanding of human olfactory perception or disorders

    • Consider how Olfr1030 ligand binding properties might contribute to biosensor development

  • Technological integration:

    • Combine ex vivo cilia preparation techniques with advanced imaging approaches for high-throughput screening

    • Implement microfluidic systems for precise odorant delivery and response measurement

    • Develop computational pipelines for integrating molecular, cellular, and systems-level data

This integrated approach connects molecular mechanisms of Olfr1030 function to broader questions in olfactory neuroscience, maximizing the impact and applicability of research findings across multiple domains.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.