Recombinant Mouse Olfactory receptor 1038 (Olfr1038)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse Olfactory Receptor 1038 (Olfr1038)

Recombinant Mouse Olfactory Receptor 1038 (Olfr1038) is a synthetic version of a pseudogene-encoded olfactory receptor protein. While the endogenous Olfr1038 gene (also known as Olfr1038-ps) is non-functional due to loss-of-function mutations, its recombinant form is widely used in biochemical and biophysical studies to investigate olfactory receptor structure, function, and signaling mechanisms . These receptors belong to the G-protein-coupled receptor (GPCR) family and typically play roles in detecting odorant molecules, though pseudogenic variants like Olfr1038 lack odorant-binding activity .

Expression Platforms

Recombinant Olfr1038 is produced via multiple systems:

  • Bacterial systems: E. coli yields high-purity proteins but may lack post-translational modifications .

  • Mammalian systems: HEK293 cells or insect cells (baculovirus) produce proteins with native-like folding and glycosylation .

  • Cell-free systems: Used for rapid expression but limited to cytosolic or membrane fractions .

Key Applications

ApplicationDetails
ELISA AssaysQuantitative detection of Olfr1038 in biological samples
ImmunoprecipitationPull-down assays using magnetic beads conjugated with recombinant Olfr1038
Structural StudiesCrystallization or cryo-EM for membrane protein analysis
Ligand ScreeningTesting odorant interactions (limited by pseudogenic status)

Functional Limitations

As a pseudogene, Olfr1038 lacks conserved residues critical for odorant binding, limiting its utility in ligand-screening studies . Instead, it serves as a model for studying receptor trafficking, folding, or GPCR signaling mechanisms .

Comparative Analysis of Olfactory Receptor Genes

Genome AssemblyRelease 12Release 13Key Differences
Total OR Genes1,4681,490Improved annotation of partial sequences
Intact ORFs866 (72%)1,107 (79%)Reduced pseudogenization in later builds

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have any specific requirements for the format, please indicate your preference when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method or location. Please consult your local distributors for specific delivery time estimates.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is advisable to add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Olfr1038; Mor185-3; Olfr1038-ps; Olfactory receptor 1038; Olfactory receptor 185-3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-319
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Olfr1038
Target Protein Sequence
MAEVNISYVSEFILKGITDRPELQAPCFVMFLTIYLVTVLGNLGLIVIIRVDSRLHTPMY FFLSHLAFVDLCYSSAITPKMMVNFVVERNTIPFHACATQLGCFLTFMITECFLLASMAY DRYVAICSPLHYSTLMSKRVCIQLVAVPYVYSFLVALFHTIITFRLTYCGPNVINHFYCD DLPLLALSCSDTHMKEILIFAFAGFDMICSSSIVLTSYLFIIAAILRIRSTQGRRKAIST CGSHMVAVTIFYGTLIFMYLQPKSNHSLDTDKMASVFYTVVIPMLNPLIYSLRNKEVKDA SKKALDKGYETLKILRLSK
Uniprot No.

Target Background

Function
This protein is a potential odorant receptor.
Database Links

KEGG: mmu:259015

UniGene: Mm.223402

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the genomic context of Olfr1038 in mice?

Olfr1038-ps is classified as an olfactory receptor pseudogene in Mus musculus (house mouse) with Entrez Gene ID 259015. Despite being annotated as a pseudogene, it is described as protein-coding in genomic databases. The gene is also known by synonyms MOR185-3 and Olfr1038 . As a member of the olfactory receptor family, it shares structural characteristics with other olfactory receptors, including a 7-transmembrane domain configuration typical of G-protein-coupled receptors (GPCRs) arising from single coding-exon genes . The nomenclature assigned to olfactory receptor genes and proteins in mice is independent of other organisms, which is an important consideration when conducting comparative genomic studies .

What cellular functions does Olfr1038 perform?

Olfr1038, like other olfactory receptors, primarily functions to interact with odorant molecules in the nasal cavity. These interactions initiate a neuronal response cascade that ultimately triggers smell perception . The olfactory receptor proteins are members of the large family of G-protein-coupled receptors (GPCRs) and share structural similarities with many neurotransmitter and hormone receptors . Their primary role involves recognition of specific odorant molecules and subsequent G protein-mediated signal transduction, converting chemical stimuli (odors) into electrical signals that can be processed by the brain .

How should experimental controls be designed when studying Olfr1038?

  • Negative controls: Experiments using non-olfactory GPCR receptors or related pseudogenes to establish baseline activity.

  • Positive controls: Using well-characterized olfactory receptors with known ligands.

  • Expression controls: Verification of successful transfection or protein expression using techniques such as Western blotting or immunofluorescence.

It is essential to identify potential extraneous and confounding variables that might influence your results, particularly in odorant response assays where contamination can significantly impact outcomes . Random assignment of experimental units to treatment groups should be implemented where possible to minimize bias .

What expression systems are most effective for recombinant Olfr1038 production?

  • Clone the Olfr1038 cDNA into an appropriate mammalian expression vector with a strong promoter.

  • Include epitope tags (e.g., FLAG, HA) for detection without disrupting protein function.

  • Transform into competent cells for plasmid amplification before transfection into mammalian cells.

  • Optimize expression conditions including temperature, induction time, and cell density.

Expression verification should be conducted using immunoblotting or fluorescence techniques, with particular attention to proper membrane localization of the receptor .

What methods can be used to validate Olfr1038 functional activity?

Validating the functional activity of Olfr1038 requires specialized assays that can detect GPCR activation in response to odorant binding. Consider these methodological approaches:

  • Calcium flux assays using fluorescent calcium indicators to measure intracellular calcium changes upon receptor activation.

  • cAMP accumulation assays that detect changes in second messenger levels.

  • β-arrestin recruitment assays to monitor receptor internalization following activation.

  • Electrophysiological recordings in cells expressing the receptor to measure membrane potential changes.

For each assay, baseline measurements should be established, followed by exposure to potential ligands. Dose-response curves should be generated to determine EC50 values and efficacy parameters. Statistical analysis should include appropriate controls and replicates to ensure reproducibility of results.

How can spectroscopic methods be optimized for studying Olfr1038 interactions with ligands?

Spectroscopic methods provide valuable insights into protein-ligand interactions. Based on techniques employed for other proteins, the following approach can be adapted for Olfr1038 studies:

  • Protein aggregation affecting spectral resolution

  • Establishment of binding equilibria requiring extended incubation times

  • Solubility limitations of hydrophobic ligands

To overcome these challenges, a modified approach using competitive binding assays with fluorescent markers can be employed. As demonstrated in other protein interaction studies, this approach involves:

  • Establishing a baseline using a fluorescent marker with known binding properties

  • Performing replacement titration experiments to determine relative binding affinities

  • Correcting spectra for phenomena such as light reabsorption

The binding parameters can be quantified using Scatchard analysis to determine binding constants and the number of binding sites, as shown in the following table format:

Ligand TypeScatchard ConstantNumber of Binding Sites
Ligand Ak.xx·10ᵏn.n
Ligand Bk.xx·10ᵏn.n

IR spectroscopy can also provide valuable information about changes in protein secondary structure upon ligand binding, potentially revealing conformational changes associated with receptor activation .

What computational approaches are most effective for predicting Olfr1038 ligand interactions?

Molecular docking represents a powerful approach for predicting Olfr1038-ligand interactions. Based on methods applied to other proteins, the following strategy can be implemented:

  • Develop or obtain a high-quality structural model of Olfr1038, potentially using homology modeling based on crystallized GPCR structures.

  • Conduct in silico screening of potential odorant molecules using molecular docking algorithms.

  • Analyze binding poses and calculate binding energies to rank potential ligands.

  • Identify key amino acid residues involved in ligand recognition through interaction analysis.

Molecular dynamics simulations can further enhance understanding by:

  • Evaluating the stability of predicted protein-ligand complexes

  • Identifying conformational changes induced by ligand binding

  • Calculating binding free energies using methods such as MM/PBSA or FEP

The computational predictions should be validated experimentally using the spectroscopic and functional assays described previously. Integration of computational and experimental approaches provides the most comprehensive understanding of Olfr1038 ligand specificity .

How can GRADE methodology be applied to systematically evaluate evidence quality in Olfr1038 research?

The Grading of Recommendations Assessment, Development and Evaluation (GRADE) approach can be adapted to systematically evaluate evidence quality in Olfr1038 research. Similar to its application in other research domains, a structured approach to presenting synthesized evidence about Olfr1038 can enhance understanding and facilitate decision-making .

  • The outcome measures relevant to Olfr1038 function or expression

  • The certainty of evidence for each outcome

  • The relative importance of different outcomes (RIO)

  • Variability measures to indicate confidence intervals or data spread

To develop an effective SoF table for Olfr1038 research:

  • Conduct interactive workshops with experts in olfactory receptor biology

  • Test prototype formats through semi-structured interviews with researchers

  • Refine the format based on feedback, potentially incorporating visual elements to clarify complex concepts

  • Validate the final format through user testing

This structured approach enhances understanding of evidence synthesis and facilitates incorporation of findings into research planning and interpretation, ultimately improving research quality and reproducibility in the Olfr1038 field.

What are the most effective strategies for resolving contradictory findings in Olfr1038 ligand identification studies?

When confronted with contradictory findings regarding Olfr1038 ligand specificity, researchers should implement a systematic approach to resolution:

  • Standardize experimental conditions across studies:

    • Use identical expression systems and cellular backgrounds

    • Standardize receptor constructs, including tags and fusion proteins

    • Implement uniform assay conditions (temperature, pH, ionic strength)

  • Perform cross-validation using multiple complementary techniques:

    • Combine functional assays (calcium imaging, cAMP accumulation) with direct binding assays

    • Employ both cell-based and cell-free systems to distinguish receptor-specific effects from cellular context effects

    • Utilize in silico predictions to guide experimental design

  • Develop a consensus ranking system for potential ligands based on:

    • Binding affinity measurements across studies

    • Activation efficacy in functional assays

    • Structural similarity to confirmed ligands

    • Evolutionary conservation of binding patterns across species

  • Implement meta-analysis techniques to:

    • Quantitatively combine results from multiple studies

    • Identify sources of heterogeneity in experimental outcomes

    • Calculate weighted effect sizes based on methodological quality

This multi-faceted approach provides a robust framework for resolving contradictory findings and establishing consensus regarding Olfr1038 ligand interactions.

How can protein interaction studies with Olfr1038 be designed to identify novel signaling pathways?

To identify novel signaling pathways associated with Olfr1038 activation, comprehensive protein interaction studies should be designed, incorporating:

  • Proximity-based labeling techniques:

    • BioID or TurboID fusion proteins to identify proteins in close proximity to Olfr1038

    • APEX2-based proximity labeling for temporal resolution of interaction dynamics

  • Co-immunoprecipitation coupled with mass spectrometry:

    • Stable isotope labeling (SILAC) to quantitatively compare interactomes

    • Crosslinking approaches to capture transient interactions

    • Sequential co-immunoprecipitation to identify multi-protein complexes

  • Live-cell imaging approaches:

    • Bioluminescence resonance energy transfer (BRET) to monitor protein-protein interactions

    • Split-protein complementation assays to visualize interactions in cellular contexts

  • Functional validation of identified interactors:

    • siRNA/shRNA knockdown to assess functional significance

    • Domain mapping to identify critical interaction interfaces

    • Pharmacological inhibition of putative signaling components

Analysis of interaction data should incorporate network-based approaches to contextualize findings within broader cellular signaling frameworks, potentially revealing unexpected connections between olfactory signaling and other cellular processes.

What quality control measures are essential for recombinant Olfr1038 preparation?

Quality control for recombinant Olfr1038 preparation requires rigorous validation at multiple stages:

  • DNA-level verification:

    • Sequence confirmation of expression constructs

    • Restriction digestion analysis to verify plasmid integrity

    • Absence of unwanted mutations, particularly in transmembrane domains

  • Protein expression verification:

    • Western blotting with appropriate antibodies

    • Mass spectrometry confirmation of protein identity

    • Glycosylation analysis if expressed in eukaryotic systems

  • Functional integrity assessment:

    • Ligand binding assays with known odorants

    • G-protein coupling efficiency measurements

    • Membrane localization confirmation through fractionation or imaging

  • Storage stability determination:

    • Activity retention after freeze-thaw cycles

    • Temperature sensitivity profiling

    • Buffer composition optimization

Documentation of these quality control measures should accompany all experimental reports to ensure reproducibility and facilitate cross-study comparisons.

How should researchers address the challenges of Olfr1038's pseudogene classification?

The classification of Olfr1038 as a pseudogene (Olfr1038-ps) presents unique research challenges requiring specific methodological considerations :

  • Sequence verification:

    • Confirm the presence of purported inactivating mutations

    • Compare sequences across mouse strains to identify potential strain-specific variations

    • Assess conservation patterns across related species

  • Transcriptional analysis:

    • Perform RT-PCR to confirm transcription

    • Conduct RNA-Seq to quantify expression levels in olfactory epithelium

    • Analyze alternative splicing patterns that might bypass pseudogene-causing mutations

  • Translational assessment:

    • Develop specific antibodies against predicted protein sequences

    • Perform ribosome profiling to assess translation efficiency

    • Conduct mass spectrometry to detect potential protein products

  • Functional testing:

    • Express the coding sequence in heterologous systems to assess functionality

    • Compare activity with closely related functional olfactory receptors

    • Investigate potential non-canonical functions independent of odorant recognition

This comprehensive approach can clarify whether Olfr1038-ps represents a true pseudogene or retains functional capacity in specific contexts.

What emerging technologies hold promise for advancing Olfr1038 research?

Several cutting-edge technologies show particular promise for advancing Olfr1038 research:

  • Cryo-electron microscopy for structural determination:

    • Potential to resolve GPCR structures in various conformational states

    • Visualization of ligand binding without crystallization requirements

    • Investigation of receptor-G protein complexes

  • CRISPR-Cas9 genome editing:

    • Generation of Olfr1038 knockout or knock-in mouse models

    • Introduction of reporter genes for in vivo visualization

    • Creation of humanized mouse models for comparative studies

  • Single-cell transcriptomics:

    • Characterization of Olfr1038 expression patterns at single-cell resolution

    • Identification of co-expressed genes in Olfr1038-positive neurons

    • Developmental trajectory analysis of receptor expression

  • Spatially resolved proteomics:

    • Mapping of protein interactions in native tissue contexts

    • Visualization of signaling complexes in olfactory cilia

    • Integration with functional imaging data

These technologies, particularly when integrated through systems biology approaches, offer unprecedented opportunities to understand Olfr1038 function within its native biological context.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.