Recombinant Mouse Olfactory receptor 1086 (Olfr1086)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Overview

Gene Symbol: Olfr1086
Entrez Gene ID: 258585
Synonyms: MOR179-2
Organism: Mus musculus (house mouse)
Gene Type: Protein-coding
Genomic Context:

  • Olfr1086 belongs to the largest gene family in the mouse genome, encoding olfactory receptors critical for odor perception .

  • Olfactory receptors interact with odorants to initiate neuronal signaling, utilizing a 7-transmembrane domain structure common to GPCRs .

Orthologs and Evolutionary Conservation

SpeciesOrthologGene IDProtein
HumanOR5T2ENSG00000181718OR5T2
RatOlr510ENSRNOG00000052014Olr510
Data sourced from cross-species genomic comparisons .

Expression Systems

  • Recombinant Olfr1086 is expressed in E. coli for high-yield production, though mammalian systems (e.g., HEK293, Neuro2A) are preferred for functional studies requiring proper membrane localization .

  • Dual-labeling strategies (e.g., fluorescent tags) are employed to quantify receptor trafficking and plasma membrane localization .

Functional Insights from Related Studies

  • Ligand Screening: Odorant libraries are used to identify agonists/antagonists for olfactory receptors . For example, Olfr73 (a related receptor) responds to eugenol but shows variable antagonism depending on cellular context .

  • Genetic Regulation: Olfr gene expression is tightly controlled by post-transcriptional features (e.g., AU-rich elements, short 3′UTRs) to enforce monoallelic expression in neurons .

Technical Challenges

  • Low plasma membrane expression in heterologous systems .

  • Dynamic odorant response profiles influenced by cellular environment (e.g., cilia-specific signaling complexes) .

Future Directions

  • Deorphanization: High-throughput screening to identify Olfr1086-specific ligands.

  • Structural Studies: Cryo-EM or X-ray crystallography to resolve ligand-binding pockets.

  • In Vivo Validation: Use of adeno-associated viruses (AAVs) for ectopic expression in olfactory neurons, as demonstrated for Olfr73 .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please include them in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
Olfr1086; Mor179-2; Olfactory receptor 1086; Olfactory receptor 179-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Olfr1086
Target Protein Sequence
MENITEVTEFILMGFTDNADLEILSFFLFLAIYLFTLMGNLGLITLVIGDSRLHNPMYYF LSVLSSVDACYSTVITPQMVVDFVSEKKVISFIGCATQMFLAVTFGTTECFLLAAMAYDR YVAIHNPLMYVVSMSPRVYVPLIIASYAGGILHAVIHTVATFRLSFCGSNKISHIFCDIP PLLAISCSDTHFNQLLLFYCAGFIEVVTILIVLLSYGFILSVILKTRSTEGKRKVFSTCG SHLMAVSTFHGTVLFMYVRPSDSYALEHDMMVSIFYSIVIPMLNPLIYSLRNKDVKEAIK KVFGKRILCG
Uniprot No.

Target Background

Function
Potential odorant receptor.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Olfr1086 and how is it classified within the mouse olfactory receptor system?

Olfr1086 (also known as Olfactory receptor 179-2) is one of approximately 1,000 different olfactory receptors in the mouse olfactory system. It belongs to the superfamily of G-protein coupled receptors that transduce odor binding into calcium influx, which ultimately leads to action potentials. Mouse olfactory receptors are organized into 241 subfamilies based on sequence relationships, with each subfamily likely recognizing structurally related odorants. Olfr1086 is part of this complex system that enables mice to detect and discriminate between a vast array of odorous molecules .

How does Olfr1086 compare structurally to other mouse olfactory receptors?

Olfr1086, like other olfactory receptors, functions as a G-protein coupled receptor with a characteristic seven-transmembrane domain structure. Its UniProt accession number is Q8VFL9, and it shares the general structural features common to the olfactory receptor family. Sequence comparisons between olfactory receptor subfamilies indicate that members within the same subfamily typically share at least 60% protein sequence identity. This high degree of sequence similarity within subfamilies suggests that Olfr1086 likely shares significant structural homology with other members of its particular subfamily, while maintaining the unique sequence variations that determine its specific odorant-binding properties .

What is known about the gene location and expression pattern of Olfr1086?

While the search results don't specify the exact chromosomal location of Olfr1086, the mouse OR gene family as a whole is distributed across 51 different loci on 17 chromosomes. Most OR subfamilies are encoded by a single chromosomal locus, suggesting that different loci may encode receptors for different types of odorant structural features. Based on general patterns of olfactory receptor expression, Olfr1086 is likely expressed in a specific subset of olfactory sensory neurons (OSNs) in the main olfactory epithelium. Each mature OSN typically expresses only one type of olfactory receptor, creating a mosaic of receptor expression across the olfactory epithelium that forms the basis for odor discrimination .

What are the optimal conditions for storing recombinant Olfr1086?

For recombinant Olfr1086, storage conditions significantly impact protein stability and shelf life. The liquid form maintains stability for approximately 6 months when stored at -20°C to -80°C, while the lyophilized form extends shelf life to 12 months at the same temperature range. To maximize stability for long-term storage, it is recommended to add glycerol to a final concentration of 5-50% (with 50% being the standard recommendation). It's crucial to avoid repeated freeze-thaw cycles as these can compromise protein integrity. For short-term work, aliquots can be stored at 4°C for up to one week. Before opening, vials should be briefly centrifuged to ensure all contents settle at the bottom, especially with lyophilized preparations .

What expression systems have been successfully used for recombinant olfactory receptors?

While the search results specifically mention E. coli as the source system for recombinant Olfr1086, research on other mouse olfactory receptors provides valuable insights into expression systems. A significant advancement was achieved with mOR256-17, which was successfully expressed in mammalian cells with yields of up to 10^6 receptors per cell. This was accomplished using a transient transfection approach in mammalian cell lines. The successful expression strategy involved optimizing several parameters, including codon usage, signal sequences, and post-translational modifications. For functional studies, mammalian expression systems often provide advantages over bacterial systems as they support proper folding and post-translational modifications essential for receptor functionality. Researchers working with Olfr1086 might consider adapting these mammalian expression protocols that have proven successful with other mouse olfactory receptors .

What reconstitution protocols are recommended for optimal Olfr1086 stability and activity?

For reconstitution of recombinant Olfr1086, a methodical approach is essential to maintain protein integrity. The lyophilized protein should be reconstituted in deionized sterile water to achieve a concentration between 0.1-1.0 mg/mL. This process should be performed with gentle mixing rather than vigorous agitation to prevent protein denaturation. After initial reconstitution, adding glycerol to a final concentration of 5-50% is recommended for stability. The reconstituted protein should be aliquoted into small volumes sufficient for single experiments to minimize freeze-thaw cycles. When preparing the protein for functional assays, it's important to consider buffer composition, pH, and the presence of potential stabilizing agents that might affect receptor conformation and activity. Detailed activity assays should be performed post-reconstitution to verify functional integrity, particularly for receptors intended for ligand-binding or signaling studies .

How can researchers effectively assess the functional activity of recombinant Olfr1086?

To functionally characterize recombinant Olfr1086, researchers can implement a multi-faceted approach similar to those used for other olfactory receptors. A dual-color labeling strategy can be particularly effective, where green fluorescent protein (GFP) is fused to the C-terminus to quantify total cellular receptor biosynthesis, while a post-translational fluorescence label (such as a 12-amino acid polypeptide tag) at the N-terminus allows selective visualization and quantification of receptors specifically at the plasma membrane. Flow cytometry can then be used to quantify cell surface expression. For functional assessment, calcium influx assays following odorant exposure provide direct evidence of receptor activation and signal transduction. Additionally, researchers can screen odorant libraries to identify specific agonists for Olfr1086, which would be essential for probing receptor function. These methodologies enable quantitative assessment of both receptor expression and functional activity .

What approaches can be used to identify potential ligands for Olfr1086?

Identifying ligands for Olfr1086 requires a systematic approach combining computational prediction and experimental validation. Initially, researchers can employ computational methods to predict potential ligands based on the receptor's sequence similarity to other ORs with known ligands. The subfamily classification of Olfr1086 may provide insights into the structural classes of odorants it might recognize, as members of the same subfamily typically respond to structurally related compounds. Experimentally, high-throughput screening of diverse odorant libraries, similar to the approach used with mOR256-17, can identify candidate ligands. This typically involves expressing the receptor in a heterologous system (such as HEK293 cells) and measuring calcium responses or cAMP production following odorant exposure. Dose-response analyses with candidate ligands can then determine specificity and potency. Advanced techniques such as molecular dynamics simulations may further elucidate the structural basis of ligand-receptor interactions .

How does transcriptional adaptation influence Olfr1086 function in different olfactory environments?

Olfactory sensory neurons (OSNs) expressing Olfr1086 likely exhibit transcriptional adaptation similar to other OSN subtypes in response to environmental odorant exposure. Research has revealed that OSNs harbor distinct transcriptomes whose content is precisely determined by interactions between the odorant receptor and the environment. This transcriptional variation involves over 70 genes relevant to odor signal transduction, which continuously vary across OSN subtypes and dynamically adjust to new environments over hours. This mechanism acts as a "transcriptional rheostat" that enables proportional and bidirectional adaptation to persistent background odors. For Olfr1086-expressing neurons, this would mean that sustained exposure to specific odorants triggers transcriptional changes that modulate receptor sensitivity, allowing for continued detection of novel stimuli against consistent background odors. This adaptation mechanism occurs before odor information is transmitted to neural circuits responsible for perception, indicating that peripheral odor codes are flexible rather than fixed .

What experimental approaches can reveal the role of Olfr1086 in the broader olfactory circuit?

To investigate Olfr1086's role in olfactory circuits, researchers should employ a multi-level experimental strategy. At the cellular level, single-cell RNA sequencing of Olfr1086-expressing neurons can reveal co-expressed genes that may modulate receptor function or axonal targeting. At the circuit level, genetic labeling of Olfr1086-expressing neurons combined with neural tracing techniques can map their projections to specific glomeruli in the olfactory bulb. Functional mapping using calcium imaging of OSN axon terminals in the olfactory bulb during odorant stimulation can reveal response properties and potential convergence with other OR-specific pathways. Optogenetic or chemogenetic manipulation of Olfr1086-expressing neurons can test their necessity and sufficiency in odor-guided behaviors. Additionally, comparing transcriptional profiles of Olfr1086-expressing neurons before and after exposure to different odor environments can elucidate how this receptor's signaling adapts to changing sensory landscapes, revealing its contribution to sensory adaptation mechanisms .

How might genetic manipulation of Olfr1086 affect olfactory perception in mouse models?

Genetic manipulation of Olfr1086 provides an opportunity to dissect its specific contribution to odor perception. Knockout approaches would help determine the behavioral significance of this receptor by assessing changes in detection thresholds, discrimination capabilities, or preference/avoidance responses to specific odorants. CRISPR-Cas9 gene editing could introduce point mutations to identify critical residues for ligand binding or signal transduction. Alternatively, replacing the Olfr1086 coding sequence with that of another OR while maintaining the Olfr1086 locus control region would help elucidate mechanisms of OR choice and axon guidance. Overexpression studies could reveal whether increased numbers of neurons expressing Olfr1086 enhance sensitivity to its cognate odorants. Because olfactory receptors function combinatorially to encode odor identities, manipulating Olfr1086 might affect the perception of complex odor mixtures beyond individual odorants. These approaches would provide insights into both the specific function of Olfr1086 and general principles of olfactory coding .

What are the challenges in correlating in vitro ligand-binding studies with in vivo olfactory responses for Olfr1086?

The correlation between in vitro ligand-binding studies and in vivo olfactory responses for Olfr1086 presents several significant challenges. First, the cellular environment in heterologous expression systems differs from native olfactory sensory neurons, potentially affecting receptor conformation, membrane localization, and coupling to signaling machinery. Second, the transcriptional adaptation mechanisms observed in OSNs create dynamic receptor sensitivities that are difficult to replicate in vitro. The expression levels of more than 70 genes relevant to transforming odors into spikes continuously vary across OSN subtypes and adjust to new environments, creating a complex signaling context. Third, in vivo responses involve not only receptor-ligand interactions but also the influence of mucosal composition, odorant-binding proteins, and metabolizing enzymes that modify odorant availability. Finally, while in vitro studies typically examine responses to single compounds, natural odors comprise complex mixtures that may exhibit synergistic or antagonistic effects at the receptor level. Addressing these challenges requires complementary approaches, including ex vivo preparations of the olfactory epithelium, in vivo calcium imaging, and behavioral assays paired with carefully controlled odorant delivery .

How do post-translational modifications influence Olfr1086 trafficking and function?

Post-translational modifications (PTMs) play crucial roles in olfactory receptor trafficking and function, likely including Olfr1086. N-linked glycosylation at the N-terminal extracellular domain is essential for proper folding and trafficking of ORs to the plasma membrane. Palmitoylation of conserved cysteine residues may anchor portions of the receptor to the membrane, affecting conformational dynamics during ligand binding. Phosphorylation by various kinases, particularly at the C-terminus, regulates receptor desensitization and internalization following activation. For effective functional studies, expression systems must support these critical PTMs. The dual-color labeling approach described for other ORs, with fluorescent tags at both N- and C-termini, can help distinguish properly folded and trafficked receptors from those retained in intracellular compartments. Mutation of putative PTM sites in Olfr1086 would help determine their specific contributions to receptor function, potentially revealing regulatory mechanisms that modulate olfactory sensitivity in response to changing odor environments .

What can structural modeling reveal about the ligand-binding domain of Olfr1086?

Advanced structural modeling of Olfr1086's ligand-binding domain can provide crucial insights into its odorant specificity. While experimental determination of OR structures remains challenging, homology modeling based on other G-protein coupled receptors (particularly those with resolved crystal structures) can predict the three-dimensional arrangement of Olfr1086's transmembrane domains. The putative binding pocket is typically formed by the extracellular portions of transmembrane helices 3, 5, and 6, with key residues that determine ligand specificity. Molecular docking simulations with predicted ligands can identify critical interaction points and binding energies. Sequence comparisons with ORs of known ligand specificity, particularly within the same subfamily, can highlight conserved and variable residues that likely contribute to shared or distinct recognition properties. These structural predictions can then guide site-directed mutagenesis experiments to validate the functional importance of specific residues. Such comprehensive structural analysis would significantly advance our understanding of the molecular basis for Olfr1086's odorant detection properties .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.