Recombinant Mouse Olfactory receptor 10 (Olfr10)

Shipped with Ice Packs
In Stock

Description

Recombinant Expression and Purification

Recombinant Olfr10 is produced using an E. coli expression system, enabling scalable synthesis for structural and functional studies. Key production details include:

ParameterDescription
Expression SystemEscherichia coli (in vitro)
TagN-terminal 10xHis-tag for purification
Storage-20°C (short term), -80°C (long term); avoid repeated freeze-thaw cycles
PurityConfirmed via SDS-PAGE and mass spectrometry
Product CodeCSB-CF733717MO (Cusabio)

Functional and Research Insights

While specific ligands for Olfr10 are not yet identified, insights from related olfactory receptors provide context:

Ligand Screening (Comparative Data)

  • Methodology: Luciferase reporter assays measuring cAMP elevation upon receptor activation .

  • Related Receptors:

    • Olfr558: Activated by carboxylic acids (e.g., butyric acid) and microbial metabolites .

    • MOR256-17: Broadly responsive to diverse odorants, studied in HEK293 cells and nanodisc systems .

Tissue Distribution

Olfr10 is primarily expressed in olfactory sensory neurons (OSNs) but may also localize to "nonsensory" tissues, as observed for other renal ORs .

Challenges and Future Directions

  1. Ligand Identification: High-throughput screening of odorant libraries is required to deorphanize Olfr10 .

  2. Structural Studies: Cryo-EM or X-ray crystallography could resolve its 3D architecture, facilitated by recombinant production .

  3. In Vivo Role: Conditional knockout models may clarify its physiological functions beyond olfaction .

References (Integrated Citations)

  • Recombinant expression protocols:

  • GPCR signaling mechanisms:

  • Tissue-specific OR roles:

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its use.
Synonyms
Olfr10; Olfactory receptor 10; Odorant receptor L45
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Olfr10
Target Protein Sequence
MGTFNISLGGGFILVGFSDWPALELIFFIHILIFYSITLFGNTAIIALSRTDLRLHTPMY FFLSHLSFLDLCFTTSTVPQLLINLHGQDRTISYGGCVAQVFIFLALGSTESVLLVVMAF DRYAAVCRPLHYTTIMHPVLCQALAIASWVGGFLNSLIQTGLMMAMPLCGHRLNHFFCEM PVFLKLVCEDTGGTEAKMFVARAVIVAVPTMLILGSYAQIARAVLKVKSVTARRKAAGTC GSHLLVVSLFYGSAIYTYLQPKDSYSESKGKFVALFYTIITPMLNPLIYTLRNKDMKGAL WKVLGRATVTG
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Olfactory Receptor 10 (Olfr10) and what is its structure?

Olfactory Receptor 10 (Olfr10) is a G protein-coupled receptor (GPCR) expressed in mouse olfactory epithelium. The full-length Olfr10 protein consists of 311 amino acids and is also known by synonyms including "Odorant receptor L45" . The protein belongs to the large family of olfactory receptors that enable mice to detect environmental chemicals and odorants. The complete amino acid sequence of Olfr10 is:

MGTFNISLGGGFILVGFSDWPALELIFFIHILIFYSITLFGNTAIIALSRTDLRLHTPMYFLSHLSFLDLCFTTSTVPQLLINLHGQDRTISYGGCVAQVFIFLALGSTESVLLVMAFDRYAAVCRPLHYTTIMHPVLCQALAIASWVGGFLNSLIQTGLMMAMPLCGHRLNHFFCEMPVFLKLVCEDTGGTEAKMFVARAVIVAVPTMLILGSYAQIARAVLKVKSVTARRKAAGTCGSHLLVVSLFYGSAIYTYLQPKDSYSESKGKFVALFYTIITPMLNPLIYTLRNKDMKGALWKVLGRATVTG

Like other olfactory receptors, Olfr10 likely features the characteristic seven-transmembrane domain structure of GPCRs, with extracellular regions involved in odorant binding and intracellular domains that interact with signaling proteins.

How is Olfr10 expressed in mouse olfactory epithelium?

Olfr10 is part of a remarkably diverse family of receptors. The house mouse has approximately 1,100 genes in the Olfr gene family, making it an excellent model organism for studying olfactory receptor genes and olfaction-related genes . Expression studies using next-generation sequencing have detected Olfr10 along with 1,087 other Olfr genes in both male and female mouse olfactory epithelium .

Olfactory receptors, including Olfr10, follow a developmental expression pattern. Single-cell RNA-Seq studies have shown that Olfr gene expression first appears at the late precursor to early immature olfactory sensory neuron (OSN) stage . The expression level increases as neurons mature, with average Olfr transcript levels measured at 735 FPKM (fragments per kilobase of transcript per million mapped reads) in early immature OSNs, increasing to 1,329 FPKM in late immature OSNs, and reaching 6,376 FPKM in mature OSNs .

Are there sex differences in Olfr10 expression?

Significant sex differences exist in the expression of olfactory receptor genes in mice. Research has revealed that Olfr genes, including Olfr10, tend to express at higher levels in males than in females . This pattern contrasts with odorant-binding protein (Obp) genes clustered on the X chromosome, which show higher expression in females .

These observations suggest a fascinating functional distinction: males may have a more active Olfr gene expression system, while females potentially possess a more efficient odorant-transporting system . This sexual dimorphism in olfactory gene expression may contribute to sex-specific differences in odor detection capabilities, though the full functional implications remain an active area of research.

What is the developmental regulation of Olfr expression in olfactory neurons?

The developmental regulation of Olfr genes, including Olfr10, follows a remarkable pattern characterized by initial promiscuity followed by selective refinement. Single-cell transcriptomics has revealed several key aspects of this process:

This developmental progression supports the "one neuron-one receptor" rule that is characteristic of the mature olfactory system, while revealing the transitional states that precede this ultimate specialization.

What experimental approaches are effective for studying Olfr10 oligomerization?

Multiple complementary techniques have proven valuable for investigating the oligomerization of olfactory receptors like Olfr10. Based on research with related receptors, three primary methods show particular utility:

  • Co-immunoprecipitation (Co-IP): This biochemical technique has been extensively used to test GPCR oligomerization. For example, with the C. elegans olfactory receptor ODR-10, researchers co-expressed Renilla luciferase-tagged receptor (ODR-10-Rluc) with GFP-tagged receptor (ODR-10-GFP2) and performed immunoprecipitation using anti-GFP antibody . The detection of luciferase activity in the immunoprecipitate provides evidence of physical interaction between the differently tagged receptors.

  • Bioluminescence Resonance Energy Transfer (BRET): BRET2 offers improved signal-to-noise ratio compared to standard BRET by providing clearer separation between the emission spectra of Renilla luciferase and green fluorescent protein . When applying this technique to Olfr10, it's critical to carefully control expression levels to minimize non-specific "bystander BRET" signals that can occur due to overexpression.

  • Split-Ubiquitin Yeast Two-Hybrid System: This approach provides an in vivo method for detecting protein-protein interactions, particularly valuable for membrane proteins like olfactory receptors. The system relies on the reconstitution of a functional ubiquitin molecule when two proteins interact, leading to the release of a transcription factor that activates reporter genes .

For rigorous results, researchers should employ multiple methods, as each has distinct strengths and limitations. Appropriate controls are essential, particularly negative controls using unrelated receptors (such as SSTR5) to confirm the specificity of detected interactions .

What are the functional implications of Olfr co-expression during development?

The co-expression of multiple Olfr genes in developing olfactory sensory neurons (OSNs) has significant functional implications for olfactory system development:

  • Transitional Expression State: The co-expression appears to represent a transitional state in the developmental progression toward the "one neuron-one receptor" organization of the mature olfactory system. This suggests a sequential process of receptor selection rather than an immediate commitment to a single receptor .

  • Competitive Selection Model: The observation that early immature OSNs express multiple Olfrs at low levels, while mature OSNs typically express predominantly one Olfr at high levels, supports a competitive selection model. In this model, one receptor gene may gain a slight expression advantage that is subsequently amplified through positive feedback mechanisms .

  • Temporal Dynamics: The developmental trajectory shows a clear pattern where co-expression of multiple Olfrs diminishes over time. In young mice (P3), highly sensitive RNA-FISH methods detected co-labeling for different Olfrs in approximately 0.41% to 0.60% of cells, whereas no co-labeled cells were observed in adults where neurogenesis has decreased .

  • Functional Maturation: The transition from promiscuous to selective Olfr expression coincides with functional maturation of OSNs. Early immature OSNs expressing multiple Olfrs often lack expression of Olfactory Marker Protein (Omp), a mature OSN marker. Half (6/12) of early immature OSNs expressing multiple Olfrs did not express Omp, indicating these cells are still undergoing maturation .

Understanding these dynamics could provide insights into the mechanisms that ensure the remarkable specificity of the mature olfactory system, where each OSN expresses predominantly one receptor from a repertoire of ~1,100 genes.

How can single-cell RNA-Seq techniques be optimized for studying Olfr expression?

Single-cell RNA-Seq has proven invaluable for studying the expression of Olfr genes, but requires careful optimization due to several challenges specific to these receptors:

  • Technical Replication: Analysis of duplicate cell samples (technical replicates) is essential for validating the expression of multiple Olfrs in specific OSNs. This approach helps account for the stochastic losses of low copy number transcripts that commonly occur in single-cell RNA-Seq data .

  • Expression Level Considerations: Olfrs present in both technical replicates tend to be expressed at higher levels, while those detected in only one replicate typically show lower expression levels. This pattern is consistent with the technical limitations in detecting low-abundance transcripts in single-cell analysis .

  • Developmental Stage Identification: Including markers for developmental stages (such as Omp for mature OSNs) in the analysis is crucial for properly interpreting Olfr expression patterns, as these patterns change dramatically during neuronal maturation .

  • Sensitivity Optimization: For detecting low-level co-expression of Olfrs, highly sensitive RNA-FISH methods with branched DNA signal amplification can provide validation of RNA-Seq findings. This approach detected co-labeling in 0.41-0.60% of cells in developing olfactory epithelium .

  • Quantitative Analysis: When analyzing Olfr co-expression, it's important to quantify not just the presence of multiple receptors but also their relative abundance. The ratio between the most abundant and secondary Olfrs changes dramatically during development, with mature OSNs showing much greater dominance of a single receptor .

By incorporating these optimizations, researchers can maximize the value of single-cell RNA-Seq for exploring the complex patterns of Olfr gene expression during development and in mature olfactory systems.

What are the best practices for handling recombinant Olfr10 protein?

Proper handling of recombinant Olfr10 protein is crucial for maintaining its structural integrity and function in experimental applications. Based on manufacturer recommendations for recombinant full-length mouse Olfr10 protein, the following best practices should be implemented:

  • Storage Conditions:

    • Store recombinant Olfr10 protein at -20°C/-80°C upon receipt

    • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

    • For working aliquots, store at 4°C for up to one week

  • Reconstitution Protocol:

    • Briefly centrifuge the vial prior to opening to bring contents to the bottom

    • Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (recommended: 50%) for long-term storage

    • Aliquot for storage at -20°C/-80°C

  • Buffer Considerations:

    • The protein is typically provided in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0

    • This buffer composition helps maintain protein stability during storage

  • Quality Control:

    • Verify protein purity (should be greater than 90% as determined by SDS-PAGE)

    • Check functionality with appropriate assays before use in critical experiments

Following these handling protocols will help ensure the stability and activity of recombinant Olfr10 protein for experimental applications.

What controls should be included when studying Olfr10 oligomerization?

When investigating Olfr10 oligomerization, incorporating appropriate controls is essential for distinguishing specific interactions from experimental artifacts. Based on established practices in GPCR oligomerization studies, the following controls should be included:

  • Negative Interaction Controls:

    • Untransformed cells or expression vectors lacking the Olfr10 insert

    • Co-expression with unrelated receptors from different GPCR families (e.g., human somatostatin receptor 5, SSTR5) to demonstrate binding specificity

    • Separately expressed Olfr10 constructs that are mixed after cell lysis (to control for post-lysis interactions)

  • Expression Level Controls:

    • For BRET experiments, maintain GFP expression levels no more than twofold greater than background to minimize non-specific "bystander BRET" due to overexpression

    • Generate samples with sequentially increasing GFP expression levels to establish proper BRET curves

  • Technical Controls for Co-Immunoprecipitation:

    • Input controls (pre-immunoprecipitation samples) to verify initial protein expression

    • Controls for non-specific binding to immunoprecipitation matrix or antibodies

    • Reverse co-immunoprecipitation (switching which protein is directly precipitated) to confirm interaction

  • BRET Specificity Controls:

    • Saturation curves with increasing acceptor:donor ratios to distinguish specific from random interactions

    • Competition with untagged receptor to demonstrate specificity

    • Negative controls using co-expressed but non-interacting proteins

  • Split-Ubiquitin Yeast Two-Hybrid Controls:

    • Positive controls using known interacting proteins

    • Negative controls with components expressed in separate yeast cells

    • Self-activation controls to check for reporter activation in absence of interaction

By incorporating these comprehensive controls, researchers can robustly establish the specificity and physiological relevance of any observed Olfr10 oligomerization.

How can researchers distinguish between specific and non-specific interactions in BRET studies of Olfr10?

  • BRET2 Implementation:

    • Utilize BRET2 rather than standard BRET when possible, as it provides clearer separation between the emission spectra of Renilla luciferase (Rluc) and green fluorescent protein (GFP2), resulting in improved signal-to-noise ratio

    • While BRET2 has lower quantum efficiency, this can be compensated for by using high-copy number plasmids under inducible promoters

  • Expression Level Control:

    • Monitor GFP intensity to generate samples with sequentially increasing expression levels

    • Conduct BRET2 experiments at GFP2 levels no more than twofold greater than background to minimize "bystander BRET" due to overexpression

    • Create a series of samples with different induction times to vary protein expression levels systematically

  • Saturation Analysis:

    • Perform saturation experiments where the donor (Rluc-tagged) construct is kept constant while the acceptor (GFP-tagged) construct is increased

    • Specific interactions produce a hyperbolic curve that reaches saturation, while non-specific interactions produce a linear relationship

  • Competition Assays:

    • Introduce untagged Olfr10 to compete with the tagged version

    • Specific interactions will show decreased BRET signal with increasing untagged competitor, while non-specific interactions are less affected

  • Negative Controls:

    • Include controls with unrelated receptors (e.g., SSTR5) that should not interact with Olfr10

    • Use Rluc and GFP2 expressed separately (not fused to receptors) to establish baseline signals

    • Include mixtures of separately expressed Olfr10-GFP2 and Olfr10-Rluc to control for post-lysis interactions

By implementing these methodological approaches, researchers can confidently differentiate between specific oligomerization of Olfr10 and non-specific protein proximity due to random collisions or overexpression artifacts.

How does Olfr10 compare to olfactory receptors in other species?

Comparative studies between mouse Olfr10 and olfactory receptors from other species provide valuable insights into evolutionary conservation and functional specialization. Research has revealed several interesting cross-species characteristics:

  • Evolutionary Conservation: Olfactory receptor genes have evolved rapidly in the mouse lineage compared to other species. This rapid evolution applies not only to Olfr genes but also to odorant-binding protein (Obp) genes . This suggests that mice may have developed specialized olfactory detection capabilities adapted to their ecological niche.

  • Cross-Species Oligomerization: Interestingly, oligomerization studies have shown that some olfactory receptors can form complexes across species. For example, C. elegans ODR-10 (an olfactory GPCR) can oligomerize with the rat I7 olfactory receptor, suggesting some conservation in the structural domains that mediate these interactions .

  • Specificity Boundaries: Despite the ability to cross-oligomerize with some olfactory receptors from other species, there are clear boundaries to this interaction capability. For instance, C. elegans ODR-10 did not oligomerize with the human somatostatin receptor 5 (a neuropeptide receptor rather than an olfactory receptor), demonstrating that these interactions maintain some specificity even across species .

  • Functional Divergence: While mouse Olfr10 shares structural similarities with olfactory receptors in other species, functional studies suggest species-specific adaptations in ligand recognition and signal transduction pathways. These differences likely reflect the diverse olfactory environments and detection needs across species.

This comparative perspective highlights both the evolutionary conservation of basic olfactory receptor structure and the species-specific adaptations that have occurred during mammalian evolution.

What are the most promising areas for future Olfr10 research?

Several promising research directions could substantially advance our understanding of Olfr10 function and regulation:

  • Ligand Discovery and Characterization: Identifying the specific odorants that activate Olfr10 remains a critical research goal. High-throughput screening approaches combined with computational modeling could accelerate the discovery of Olfr10 ligands and help define its odorant response profile.

  • Structural Biology Approaches: Determining the three-dimensional structure of Olfr10 would provide unprecedented insights into its ligand-binding pocket and activation mechanisms. Advances in cryo-electron microscopy and computational methods may make this increasingly feasible.

  • Developmental Regulation Mechanisms: Further investigation into the molecular mechanisms that govern the transition from multi-Olfr expression to the "one neuron-one receptor" rule could reveal fundamental principles of neuronal specialization . Epigenetic approaches examining chromatin modifications at the Olfr locus during development may be particularly informative.

  • Functional Significance of Sexual Dimorphism: The observed sex differences in Olfr gene expression, including Olfr10, warrant further investigation into their functional consequences. Behavioral studies comparing olfactory capabilities between male and female mice could reveal if these expression differences translate to performance differences .

  • Single-Cell Multi-Omics Integration: Combining single-cell transcriptomics with epigenomics and proteomics could provide a more comprehensive understanding of how Olfr10 expression is regulated and how the protein functions within the context of the whole cell .

  • Role in Neural Circuit Development: Investigating how Olfr10-expressing neurons integrate into the olfactory bulb and form functional circuits could reveal principles of activity-dependent wiring in the olfactory system.

These research directions promise to yield valuable insights into the molecular mechanisms of olfaction and potentially inform applications in sensory neuroscience, bioengineering, and the development of olfactory-based biosensors.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.