Recombinant Mouse Olfactory receptor 12 (Olfr12)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you require a specific format, please specify it in your order notes. We will then prepare the product accordingly.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us and we will prioritize developing the specified tag.
Synonyms
Olfr12; Olfactory receptor 12; Odorant receptor M76
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-333
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Olfr12
Target Protein Sequence
MATAVHRNGSLTPVSLRVFVLVGFGGGALTQALLFAVFLVLYVVTVLGNLTMIVVITLDA RLHSPMYFFLKNLSFVDLCYSSAIAPNALANFLSTSKVISFEACATQFFFFSLLATTETF LLAVMAYDRFMAICSPLRYPVTMCPTTCTRLVLGTFCVGCLNSIVQTSLTFQLPFCSSNR IDHFYCDVPPLLQLACASTALNELFLFGLCGFIIVSTTLAVLVSYGYITVTILRMHSGSG RHKVFSTCGSHLTAVSLFYGTLFVMYAQPGALTSMEQGKVVSIFYTLVIPMLNPLIYSLR NKDVKDALQRLGQRHSLVKAVRGCPAAGGNASV
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What are the fundamental challenges in expressing mouse olfactory receptors like Olfr12 in heterologous systems?

Olfactory receptors (ORs), including mouse Olfr12, present significant expression challenges due to their nature as seven-transmembrane G protein-coupled receptors. The primary difficulties include poor trafficking to the plasma membrane, misfolding, and aggregation in the endoplasmic reticulum. These issues result in low surface expression levels, often insufficient for structural and biophysical studies. Additionally, recombinant ORs frequently fail to couple effectively with signaling machinery in heterologous systems, complicating functional characterization .

To overcome these challenges, researchers have developed several strategies:

  • Using specialized expression vectors with strong promoters

  • Incorporating N-terminal signal sequences to enhance membrane targeting

  • Adding chaperone proteins to improve folding

  • Generating fusion constructs with fluorescent proteins for trafficking visualization

  • Creating chimeric receptors with segments from better-expressed GPCRs

How can I quantify the expression levels of recombinant Olfr12?

Quantification of recombinant Olfr12 expression can be achieved through multiple complementary approaches, similar to methods used for other olfactory receptors. A dual-color labeling approach has proven particularly effective for quantifying both total cellular OR production and surface expression .

For total cellular expression quantification:

  • Fusion of green fluorescent protein (GFP) to the C-terminus of the receptor allows visualization and quantification of total biosynthesis

  • Western blotting with anti-tag antibodies (if epitope tags are incorporated)

  • ELISA-based methods for protein quantification

For surface expression quantification:

  • Post-translational fluorescence labeling of N-terminal tags (such as a 12-amino acid polypeptide sequence) enables selective visualization of receptors that have successfully trafficked to the plasma membrane

  • Flow cytometry analysis of surface-expressed receptors using fluorescent antibodies against N-terminal tags

  • Biotinylation of surface proteins followed by pull-down and immunoblotting

This dual-labeling approach provides comprehensive data on both production efficiency and trafficking success, allowing optimization of expression conditions .

What expression systems are most suitable for recombinant Olfr12 production?

Based on research with other mouse olfactory receptors, several expression systems have been evaluated for OR production, each with distinct advantages and limitations:

Expression SystemAdvantagesLimitationsApproximate Yield
HEK293 cells (transient)Mammalian processing, rapid results, efficient transfectionVariable expression, limited scale-upUp to 10^6 receptors/cell
Stable mammalian cell linesConsistent expression, scalableTime-consuming to develop, potential silencing10^5-10^6 receptors/cell
Sf9 insect cellsHigher protein yield, post-translational modificationsDifferent glycosylation pattern10^6-10^7 receptors/cell
Yeast (P. pastoris)Cost-effective, scalableNon-mammalian processing10^5-10^6 receptors/cell
Cell-free systemsRapid, avoids toxicity issuesLacks native membrane environmentVariable

For most functional and structural studies of Olfr12, mammalian expression systems like HEK293 cells are recommended as they provide the most native-like processing environment. Transient transfection of mammalian cells has been shown to yield approximately 10^6 ORs per cell, which is sufficient for many functional assays .

What are the most effective methods for identifying specific agonists for Olfr12?

Identifying specific agonists for olfactory receptors like Olfr12 typically involves screening diverse odorant libraries using functional assays that detect receptor activation. Based on approaches used for other olfactory receptors, the following methods are recommended:

  • Calcium imaging assays: Cells expressing Olfr12 and a calcium-sensitive fluorescent indicator (e.g., Fura-2) are exposed to potential odorants, with receptor activation measured as changes in intracellular calcium.

  • cAMP reporter assays: Since ORs typically signal through Gαolf leading to cAMP production, cAMP-responsive reporter systems (such as CRE-luciferase or GloSensor) can detect receptor activation.

  • High-throughput screening: Screening large odorant libraries using automated fluorescence or luminescence plate readers can identify novel ligands. This approach was successfully used to discover selective agonists for mouse receptor mOR256-17 .

  • Electrophysiological recordings: More labor-intensive but highly sensitive, patch-clamp recordings can detect membrane currents following receptor activation.

  • DREAM (Deorphanization of Receptors based on Expression Alterations in mRNA levels) assay: This in vivo approach identifies receptor-ligand pairs based on the downregulation of receptor mRNA following odorant exposure .

When characterizing the receptor's response profile, it's important to:

  • Test compounds across concentration ranges (typically 10^-9 to 10^-3 M)

  • Include appropriate positive and negative controls

  • Determine EC50 values for active compounds

  • Test structural analogs to establish structure-activity relationships

How can I determine the specificity and sensitivity of Olfr12 to different odorants?

Determining the specificity and sensitivity of Olfr12 requires systematic characterization of its response to various odorants across concentration ranges. Based on methods used for other ORs, the following approach is recommended:

  • Dose-response measurements: Test active compounds across multiple concentrations (typically 8-10 dilutions covering several orders of magnitude) to generate full dose-response curves.

  • Hill function fitting: Response data should be fitted to a Hill function to determine key parameters:

    • EC50 (concentration producing half-maximal response)

    • Hill coefficient (reflecting cooperativity)

    • Maximum response amplitude

The Hill function used is typically:
R = Rmax × C^n / (EC50^n + C^n)

Where R is the response amplitude, C is the odorant concentration, EC50 is the concentration producing half-maximal response, and n is the Hill coefficient .

  • Specificity testing: Screen structurally related compounds to establish structure-activity relationships and determine the molecular features required for receptor activation.

  • Receptor cross-reactivity: Test odorants known to activate other ORs to assess the uniqueness of the receptor's response profile.

  • Behavioral validation: For the most definitive assessment, correlate in vitro findings with in vivo odor detection thresholds using mouse behavioral assays .

What behavioral assays can be used to validate Olfr12 function in vivo?

To validate the function of Olfr12 in vivo, several behavioral paradigms can be employed similar to those used for other olfactory receptors:

  • Go/No-Go odor detection task: Mice are trained to respond (lick) to the presence of an odor (Go) and withhold response to its absence (No-Go). This paradigm can determine detection thresholds by testing increasingly dilute odorant concentrations. Critical aspects include:

    • Proper stimulus delivery using a flow dilution olfactometer

    • Precise control of odorant concentration

    • Randomization of stimulus presentation

    • Careful assessment of non-olfactory cues

  • Two-alternative forced choice: Mice must choose between two odor ports, with the target odor indicating the location of a reward.

  • Habituation-dishabituation: This measures the natural tendency of mice to investigate novel odors and habituate to familiar ones, requiring no training.

  • Genetic approach: Comparing detection thresholds between wild-type mice and those with targeted Olfr12 gene deletion can definitively link the receptor to specific odorant detection capabilities.

Implementing these behavioral assays requires careful attention to several factors:

  • Precise control of odorant delivery and concentration

  • Prevention of contamination between trials

  • Sufficient training of animals to reliable performance levels

  • Monitoring of potential experimental confounds such as auditory or visual cues

How can I optimize transfection and expression conditions for maximum functional Olfr12 yield?

Optimizing transfection and expression conditions for maximum functional yield of recombinant Olfr12 requires systematic testing of multiple variables. Based on successful approaches with other olfactory receptors, consider the following strategies:

  • Vector design optimization:

    • Test multiple promoters (CMV, EF1α, UbC) to identify optimal transcriptional activity

    • Include a Kozak consensus sequence for efficient translation initiation

    • Incorporate N-terminal signaling sequences (e.g., from rhodopsin) to enhance membrane trafficking

    • Add C-terminal tags (e.g., GFP) to monitor expression while ensuring they don't interfere with function

  • Transfection parameter optimization:

    • Compare different transfection reagents (lipid-based, calcium phosphate, electroporation)

    • Optimize DNA:reagent ratios and concentrations

    • Test multiple cell densities at time of transfection

    • Evaluate co-transfection with accessory proteins (RTP1S, Ric8b, Gαolf)

  • Culture condition optimization:

    • Test various temperatures (30-37°C) during expression

    • Optimize incubation time post-transfection (24-72 hours)

    • Evaluate media supplements that may enhance folding (glycerol, DMSO at low concentrations)

    • Consider sodium butyrate addition to enhance expression

  • Quantitative assessment:

    • Use dual-color labeling approach to monitor both total expression and surface trafficking

    • Implement flow cytometry for quantitative analysis of expression levels

    • Combine with functional assays to ensure proteins are not only expressed but functional

This systematic approach, combined with careful quantification at each step, has been shown to achieve up to 10^6 functional ORs per cell in mammalian expression systems .

What are the critical factors in designing olfactometer experiments for Olfr12 ligand screening?

Designing effective olfactometer experiments for Olfr12 ligand screening requires careful attention to multiple technical factors that can impact experimental outcomes:

  • Olfactometer design and operation:

    • Use a flow dilution olfactometer with precise control of odorant concentration

    • Implement dual synchronous three-way solenoid valves to prevent pressure spikes during odor delivery

    • Ensure balanced flow rates between odor and clean air lines

    • Use separate dedicated olfactometers for different odorants to prevent cross-contamination

  • Stimulus preparation and delivery:

    • Select appropriate solvents (water for hydrophilic compounds, mineral oil for hydrophobic ones)

    • Create serial dilutions covering a wide concentration range (typically 10^-9 to 10^-3 M)

    • Allow proper equilibration time for headspace development

    • Account for differences in vapor pressure between odorants when comparing potencies

    • For high vapor pressure odorants (like amines), implement special protocols to minimize contamination

  • Experimental controls:

    • Include blank controls (solvent only) for both Go and No-Go stimuli

    • Randomize vial positions to control for potential position effects

    • Implement non-odor cue controls to ensure responses are olfactory-specific

    • Include positive control odorants with known activity at other ORs

  • Olfactometer maintenance:

    • Replace odorant vials daily to maintain consistent concentrations

    • Flush the system with clean air between trials

    • Perform regular cleaning with isopropanol or ethanol

    • For highly volatile or sticky odorants, replace delivery tubing regularly

Implementing these practices helps ensure reliable and reproducible data when screening for Olfr12 ligands.

How do I analyze and interpret dose-response data for Olfr12 activation?

Analyzing and interpreting dose-response data for Olfr12 activation requires rigorous statistical approaches and careful consideration of experimental variables:

  • Data preprocessing:

    • Normalize responses to account for variations in expression levels between experiments

    • Apply appropriate baseline correction

    • Identify and handle outliers using established statistical methods

    • Transform data if necessary (e.g., log transformation of concentration values)

  • Curve fitting:

    • Fit normalized response data to the Hill equation:
      R = Rmax × C^n / (EC50^n + C^n)

    • Extract key parameters: EC50 (potency), Hill coefficient (cooperativity), and Rmax (efficacy)

    • Use nonlinear regression with appropriate constraints

    • Calculate confidence intervals for each parameter

  • Statistical comparison:

    • Use sum-of-squares F-test to compare EC50 values between different ligands

    • Apply appropriate multiple comparison corrections when testing numerous compounds

    • Consider analysis of variance (ANOVA) for comparing responses across multiple conditions

  • Interpretation considerations:

    • Distinguish between partial and full agonists based on Rmax values

    • Evaluate structure-activity relationships by comparing EC50 values of structurally related compounds

    • Consider possible receptor desensitization at high odorant concentrations

    • Account for potential solubility limitations of hydrophobic odorants at high concentrations

  • Visualization:

    • Present data as semi-logarithmic plots (log concentration vs. response)

    • Include error bars representing SEM or 95% confidence intervals

    • Consider heat maps for comparing responses across multiple receptors and ligands

Following these analytical approaches ensures rigorous interpretation of Olfr12 pharmacological properties and facilitates comparison with other olfactory receptors .

What protein modifications can improve the functional expression of Olfr12?

Based on successful strategies with other olfactory receptors, several protein modifications can significantly improve the functional expression of Olfr12:

  • N-terminal modifications:

    • Addition of well-folding protein domains (e.g., maltose-binding protein) at the N-terminus

    • Incorporation of the first 20 amino acids from rhodopsin as a trafficking signal

    • Codon optimization of the N-terminal region to improve translation efficiency

    • Addition of N-terminal epitope tags for detection and purification that don't interfere with signaling

  • C-terminal modifications:

    • Fusion with fluorescent proteins (e.g., GFP) for expression monitoring and localization studies

    • Addition of peptide tags for detection and purification

    • Incorporation of ER export signals to improve trafficking

    • Removal of potential ER retention signals

  • Transmembrane domain modifications:

    • Site-directed mutagenesis of specific residues to improve folding

    • Creating chimeric receptors with transmembrane domains from well-expressed GPCRs

    • Altering potential glycosylation sites to improve processing

  • Co-expression with accessory proteins:

    • Receptor transporting proteins (RTPs), particularly RTP1S

    • Receptor expression enhancing protein (REEP)

    • Ric-8B, a guanine nucleotide exchange factor

    • Gαolf or other G-proteins to facilitate coupling

Implementing these modifications has been shown to increase functional OR expression in mammalian cells by 10-100 fold, enabling sufficient protein levels for detailed biophysical and structural studies .

What computational approaches can predict potential ligands for Olfr12?

Computational approaches offer powerful tools for predicting potential ligands for Olfr12, accelerating the discovery process:

  • Homology modeling and molecular docking:

    • Generate 3D structural models of Olfr12 based on known GPCR crystal structures

    • Identify the putative binding pocket through sequence analysis and structural comparison

    • Perform virtual screening by docking compound libraries into the predicted binding site

    • Rank compounds based on predicted binding energies and interaction patterns

  • Pharmacophore modeling:

    • Develop pharmacophore models based on known ligands of related olfactory receptors

    • Identify key features (hydrogen bond donors/acceptors, hydrophobic regions, etc.)

    • Screen virtual libraries for compounds matching the pharmacophore

    • Refine models iteratively as experimental data becomes available

  • Machine learning approaches:

    • Train classification or regression models using datasets of known OR-ligand pairs

    • Incorporate molecular descriptors and fingerprints to capture structural features

    • Apply trained models to predict novel ligands for Olfr12

    • Implement active learning strategies to guide experimental validation

  • Molecular dynamics simulations:

    • Perform molecular dynamics simulations of Olfr12 with candidate ligands

    • Analyze binding stability and conformational changes induced by ligand binding

    • Calculate binding free energies using methods like MM-PBSA or FEP

    • Identify key residues involved in ligand recognition

  • Chemoinformatic analysis:

    • Apply similarity searching based on known ligands of related receptors

    • Use scaffold hopping to identify structurally diverse compounds with similar properties

    • Implement fingerprint-based methods to quantify chemical similarity

    • Analyze structure-activity relationships from experimental data to refine predictions

These computational approaches should be used in an integrated pipeline, with experimental validation of top predictions to refine models in an iterative process.

How can I differentiate between specific binding to Olfr12 and non-specific effects in ligand screening?

Differentiating between specific Olfr12 activation and non-specific effects is crucial for accurate ligand identification. Several complementary approaches should be implemented:

  • Appropriate negative controls:

    • Mock-transfected cells (vector without Olfr12)

    • Cells expressing an unrelated olfactory receptor

    • Cells with expression of signaling components but no receptor

    • Testing responses in the presence of competitive antagonists (if available)

  • Dose-response relationships:

    • Specific receptor-mediated responses typically show sigmoidal dose-response curves

    • Non-specific effects often show linear concentration dependence or threshold effects

    • Calculate and compare Hill coefficients (specific binding typically shows values near 1)

    • Compare EC50 values between Olfr12 and control receptors

  • Structure-activity relationship analysis:

    • Test structural analogs of active compounds

    • Specific binding shows clear structure-activity relationships

    • Non-specific effects often occur across structurally diverse compounds

  • Receptor mutagenesis:

    • Introduce point mutations in predicted binding pocket residues

    • Specific interactions will be disrupted by targeted mutations

    • Non-specific effects typically persist despite receptor mutations

  • Orthogonal assay validation:

    • Confirm activity using multiple, mechanistically distinct assays

    • Compare calcium mobilization, cAMP production, and receptor internalization

    • Use direct binding assays (if feasible) to confirm physical interaction

  • Time course analysis:

    • Specific receptor activation typically shows characteristic activation kinetics

    • Non-specific effects may show immediate responses or unusual temporal patterns

Implementing these approaches in combination provides strong evidence for distinguishing specific Olfr12 activation from non-specific effects, increasing confidence in identified ligands.

How can single-cell RNA sequencing enhance our understanding of Olfr12 expression patterns?

Single-cell RNA sequencing (scRNA-seq) offers powerful approaches to characterize Olfr12 expression patterns with unprecedented resolution:

  • Cell-type specific expression mapping:

    • Identify precise subtypes of olfactory sensory neurons (OSNs) expressing Olfr12

    • Determine whether Olfr12 follows the "one receptor, one neuron" rule or shows exceptions

    • Map zonal distribution of Olfr12-expressing cells within the olfactory epithelium

    • Quantify expression levels across individual cells to assess heterogeneity

  • Developmental trajectory analysis:

    • Track Olfr12 expression during OSN development and maturation

    • Identify transcription factors correlated with Olfr12 activation or repression

    • Map temporal dynamics of receptor choice and commitment

    • Characterize the cell state transitions leading to stable Olfr12 expression

  • Co-expression network analysis:

    • Identify genes consistently co-expressed with Olfr12

    • Discover potential regulatory factors controlling Olfr12 expression

    • Map the signaling components specifically enriched in Olfr12-expressing neurons

    • Build gene regulatory networks to understand receptor choice mechanisms

  • Comparative analysis across conditions:

    • Compare Olfr12 expression patterns between different physiological states

    • Assess changes after odorant exposure using the DREAM assay principle

    • Examine alterations in disease models or following injury

    • Study age-related changes in expression patterns

  • Integration with spatial transcriptomics:

    • Combine scRNA-seq with spatial mapping techniques

    • Correlate Olfr12 expression with position in the olfactory epithelium

    • Map projections of Olfr12-expressing neurons to specific glomeruli

    • Create comprehensive spatial-molecular atlases of the olfactory system

This multi-dimensional characterization of Olfr12 expression provides crucial context for functional studies and reveals the underlying regulatory mechanisms controlling receptor expression.

What are the most promising biotechnological applications for recombinant Olfr12?

Recombinant Olfr12, like other olfactory receptors, has significant potential for various biotechnological applications:

  • Biosensor development:

    • Creating cell-based biosensors for environmental monitoring

    • Developing portable devices for detecting specific chemicals

    • Engineering sensor arrays for complex odor discrimination

    • Building implantable biosensors for medical diagnostics

  • Drug discovery applications:

    • Screening for novel modulators of olfactory signaling

    • Identifying compounds for treating anosmia or hyperosmia

    • Developing drugs targeting non-olfactory GPCRs using insights from OR structure-function relationships

    • Creating high-throughput screening platforms for GPCR-targeted drug discovery

  • Synthetic biology approaches:

    • Engineering mammalian cells with synthetic olfactory circuits

    • Creating novel biosynthetic pathways triggered by olfactory signals

    • Developing cell-based "smell printers" for odor reproduction

    • Engineering bacteria or yeast to detect specific volatile compounds

  • Fundamental research tools:

    • Using Olfr12 as a reporter system for GPCR signaling studies

    • Developing optogenetic or chemogenetic variants for precise control

    • Creating biosensors for studying G-protein signaling dynamics

    • Investigating structure-function relationships in the GPCR superfamily

  • Biomedical applications:

    • Developing diagnostic tools for diseases with olfactory signatures

    • Creating implantable sensors for monitoring metabolic conditions

    • Engineering therapeutic cells responsive to specific molecular signals

    • Building biohybrid systems interfacing biological and electronic components

The successful development of these applications depends on optimizing Olfr12 expression, stability, and signaling properties, along with appropriate immobilization and detection technologies.

How can CRISPR-Cas9 gene editing be used to study Olfr12 function in vivo?

CRISPR-Cas9 gene editing provides powerful approaches to investigate Olfr12 function in vivo through various genetic modifications:

  • Knockout studies:

    • Generate complete Olfr12 knockout mice to assess its contribution to odor perception

    • Create conditional knockouts to study temporal aspects of receptor function

    • Develop tissue-specific knockouts to distinguish peripheral versus central effects

    • Compare behavioral thresholds for Olfr12 ligands between wild-type and knockout animals

  • Reporter knock-ins:

    • Insert fluorescent protein genes (GFP, tdTomato) in-frame with Olfr12

    • Create split-GFP complementation systems to visualize receptor trafficking

    • Develop calcium or cAMP reporter knock-ins for functional imaging

    • Engineer chemogenetic tags for specific activation of Olfr12-expressing neurons

  • Point mutations:

    • Introduce specific mutations in the binding pocket to alter ligand specificity

    • Modify key residues involved in G-protein coupling

    • Create phosphorylation-deficient variants to study desensitization

    • Engineer thermostable variants for improved expression and structural studies

  • Regulatory element engineering:

    • Modify Olfr12 promoter regions to study expression control

    • Engineer inducible expression systems for temporal control

    • Create artificial enhancers to drive expression in specific cell populations

    • Develop reporter constructs to monitor regulatory element activity

  • Circuit mapping approaches:

    • Insert trans-synaptic tracers under Olfr12 promoter control

    • Engineer activity-dependent markers in Olfr12-expressing cells

    • Develop optogenetic actuators for precise control of Olfr12-expressing neurons

    • Create input-specific labeling systems to map connectivity

These genetic approaches, combined with behavioral testing, electrophysiology, and imaging, provide comprehensive insights into Olfr12 function within the intact olfactory system.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.