Recombinant Mouse Olfactory receptor 13 (Olfr13)

What is the molecular structure of Mouse Olfactory Receptor 13 (Olfr13)?

Olfr13 is a full-length protein consisting of 310 amino acids (UniProt ID: P34984). Like other olfactory receptors, it belongs to the G protein-coupled receptor (GPCR) family characterized by seven transmembrane domains. The complete amino acid sequence is:

MGNNMTLITEFILLGFPLSPRMQMLLFALFSLFYAFTLLGNGTIVGLICLDSRLHTPMYFFLSHLAIVDIAYACNTVPQMLVNLLDPVKPISYAGCMTQTFLFLTFAITECLLLVVMSYDRYVAICHPLRYSAIMSWRVCSTMAVTSWIIGVLLSLIHLVLLLPLPFCVSQKVNHFFCEITAILKLACADTHLNETMVLAGAVSVLVGPFSSIVVSYACILGAILKIQSEEGQRKAFSTCSSHLCVVGLFYGTAIVMYVGPRHGSPKEQKKYLLLFHSLFNPMLNPLIYSLRNSDVKNTLKRVLRTQRAL

The protein structure includes regions responsible for odorant binding and signal transduction, which are critical for its function in the olfactory system.

How does Olfr13 fit into the broader context of mouse olfactory receptors?

Mouse olfactory receptors comprise approximately 1100 different types expressed by olfactory sensory neurons in the main olfactory epithelium . Each mature OSN typically expresses only one allele of a single OR gene, a phenomenon known as the "one neuron-one receptor" rule . Olfr13 is one member of this large family, with specific properties that distinguish it from other ORs.

The mouse OR family includes subfamilies with varying odorant response profiles, from highly selective to exceptionally broad. For instance, MOR256-17 exhibits extremely broad odorant responsiveness, while others like SR1 (Olfr124/MOR256-3) also demonstrate broad but distinct response profiles . Understanding Olfr13's position within this spectrum requires functional characterization through experimental approaches described in subsequent sections.

What expression systems are most effective for recombinant Olfr13 production?

Recombinant Olfr13 can be effectively expressed in several systems, each with distinct advantages:

E. coli expression system: This bacterial system offers high protein yields and is suitable for structural studies. Recombinant full-length mouse Olfr13 can be expressed in E. coli with an N-terminal His-tag for purification purposes . The protocol typically involves:

• Transformation of E. coli with an expression vector containing the Olfr13 gene

• Induction of protein expression

• Cell lysis and protein extraction

• Purification via His-tag affinity chromatography

• Storage as lyophilized powder or in appropriate buffer conditions with 5-50% glycerol at -20°C/-80°C

Mammalian expression systems: For functional studies, HEK293T cells may provide better protein folding and post-translational modifications, similar to the systems used for other olfactory receptors such as MOR256-17 .

In vivo genetic approaches: For physiologically relevant studies, transgenic mice overexpressing specific ORs can be generated. These approaches, while not documented specifically for Olfr13, have been used for other ORs and involve using gene choice enhancers to boost representation of the OR of interest .

What methodologies are available for functional characterization of recombinant Olfr13?

Several approaches can be employed to characterize Olfr13 function:

Patch-clamp electrophysiology: This technique allows direct measurement of OR-mediated electrical responses in individual OSNs. Similar to studies with MOR256-17 and SR1, this approach can analyze spontaneous activity, current-induced activity, and odorant-evoked responses .

Isolated cilia preparations: Cilia can be isolated from transgenic mice expressing the OR of interest and used for functional assays. These preparations maintain the native signaling machinery and can be aliquoted and stored for extended periods .

cAMP assays: Since ORs signal through G protein-coupled pathways that elevate cAMP levels, adenylyl cyclase assays combined with commercial cAMP detection kits can measure OR activation in response to odorants. This approach requires:

• Isolation of cilia containing the OR

• Exposure to potential ligands

• Measurement of cAMP production

• Comparison to appropriate controls (e.g., wild-type samples)

Calcium imaging: For real-time visualization of OR activation, calcium indicators like GCaMP6f can be employed. This approach has been used with other ORs by targeting the fluorescent sensor to olfactory cilia in transgenic lines .

How can researchers determine the odorant response profile of Olfr13?

Determining the odorant response profile requires systematic testing with diverse odorant panels. A comprehensive approach would include:

Step 1: Establish a baseline response profile

• Test Olfr13 against a diverse panel of odorants representing different chemical classes

• Include both structurally simple molecules and complex odorants

• Determine concentration-response relationships for active ligands

Step 2: Comparative analysis with related ORs

• Compare response profiles with other MOR family receptors

• Analyze similarities and differences in odorant recognition

• Determine if Olfr13 has broad or narrow tuning properties, similar to studies conducted with MOR256-17 and SR1

Step 3: Structure-activity relationship analysis

• Test structurally related odorants to define molecular features required for activation

• Analyze the effect of functional groups, carbon chain length, and structural rigidity

• Develop predictive models for Olfr13 ligand binding

Step 4: In vivo validation

• Confirm findings from in vitro studies with ex vivo or in vivo approaches

• Track glomerular formation and function in Olfr13-expressing mice

• Correlate odorant responses with behavioral outputs

What approaches can be used to investigate Olfr13 promoter architecture and transcriptional regulation?

Understanding the transcriptional control of Olfr13 expression requires analysis of its promoter architecture:

Promoter identification and characterization:

• nanoCAGE technology can be employed to profile the transcriptome and active promoters in the MOE, similar to approaches that mapped promoters for 87.5% of mouse OR genes

• This approach reveals transcription start sites (TSSs) and promoter architecture

Regulatory element identification:

• Identify potential transcription factor binding sites within the Olfr13 promoter

• Candidate transcription factors for OR gene expression include TBP, EBF1 (OLF1), and MEF2A, which have been confirmed to bind OR promoters

Chromatin immunoprecipitation (ChIP):

• Confirm binding of candidate transcription factors to the Olfr13 promoter

• Compare binding patterns with other OR promoters to identify common and distinctive regulatory mechanisms

Analysis of noncoding RNAs:

• Investigate potential antisense transcripts at the Olfr13 locus

• Characterize their role in regulating Olfr13 expression, as noncoding RNAs have been identified at other OR loci

How should researchers normalize and analyze data from Olfr13 activation assays?

Data normalization and analysis are critical for accurate interpretation of Olfr13 activation assays:

For cAMP-based assays:

• Normalize raw cAMP measurements to account for variations in cilia preparations:

  • Calculate the fold change over baseline: [(Ligand-DMSO)/DMSO]

  • Compare transgenic (TG) responses to wild-type (WT) controls

  • For potential inhibitory effects (e.g., musk compounds), correct with the formula: [(Ligand-DMSO)/DMSO]TG+1-(mean of [(Ligand-DMSO)/DMSO]WT)

• Statistical analysis:

  • Perform at least 3 technical replicates and 3-5 biological replicates

  • Define a successful response as a statistically significant (p<0.05) increase in transgenic samples compared to non-transgenic controls

For electrophysiological recordings:

• Analyze multiple parameters including response amplitude, duration, and kinetics

• Compare membrane properties between Olfr13-expressing OSNs and control populations to distinguish OR-specific effects from general neuronal properties

Six essential parameters for successful OR profiling:

• Sensitivity

• Selectivity

• Reproducibility

• Dose-dependency

• Comparison with control samples

• Statistical significance across multiple biological replicates

What are the common pitfalls in interpreting Olfr13 functional data, and how can they be addressed?

Several challenges arise when interpreting Olfr13 functional data:

Challenge 1: Distinguishing specific from non-specific responses

• Solution: Include appropriate controls, such as non-transgenic samples or samples expressing different ORs

• Compare response patterns across multiple assay platforms

• Test for dose-dependency, as specific responses typically show clear concentration-response relationships

Challenge 2: Variability between expression systems

• Solution: Compare results from different expression systems (E. coli, HEK293T cells, native OSNs)

• Consider that native systems include all required binding and accessory factors for proper OR signaling

• Validate key findings across multiple platforms

Challenge 3: Addressing the full functionality of ORs

• Solution: Evaluate all three required functions of ORs:

  • Odorant binding

  • Promotion of neuronal maturation

  • Proper axon guidance

• Consider an OR non-functional if it fails in any of these aspects, even if the protein is expressed

Challenge 4: Membrane integration and proper folding

• Solution: Assess protein quality via biochemical and biophysical methods

• Confirm membrane localization through imaging techniques

• Consider native-like membrane environments for functional studies, such as nanodiscs or biomimetic chemical sensors

How might comparative studies between Olfr13 and other olfactory receptors advance our understanding of olfactory coding?

Comparative studies offer valuable insights into olfactory coding principles:

Cross-family comparisons:

• Compare Olfr13 with well-characterized ORs like MOR256-17 and SR1

• Analyze similarities and differences in response breadth, sensitivity, and selectivity

• Identify conserved and divergent structural features that determine response properties

Evolutionary analysis:

• Compare mouse Olfr13 with orthologous receptors in other species

• Investigate how receptor function has evolved to adapt to different ecological niches

• Identify conserved ligand-binding motifs across species

Structure-function relationships:

• Use comparative data to develop predictive models of OR-ligand interactions

• Identify critical residues through mutagenesis studies

• Apply insights to understand the broader principles of GPCR-ligand interactions

Integration with neural circuit analysis:

• Map the glomerular targets of Olfr13-expressing OSNs

• Compare with projection patterns of OSNs expressing related ORs

• Understand how receptor diversity contributes to olfactory map formation and odor discrimination

What novel methodological approaches might enhance Olfr13 research in the future?

Emerging technologies promise to advance Olfr13 research:

Single-cell omics approaches:

• Single-cell RNA sequencing to profile gene expression in Olfr13-expressing OSNs

• Spatial transcriptomics to map receptor expression in the MOE

• Multi-omics integration to understand the relationship between receptor expression and function

Advanced structural biology techniques:

• Cryo-electron microscopy for high-resolution structural analysis of Olfr13

• Molecular dynamics simulations to model ligand-receptor interactions

• Structure-based drug design principles applied to odorant-OR interactions

In vivo functional imaging:

• Development of reporter systems for real-time monitoring of Olfr13 activation in living animals

• Two-photon imaging of glomerular responses to odorants

• Correlation of receptor activation patterns with behavioral outputs

Gene editing approaches:

• CRISPR-Cas9 modification of Olfr13 to introduce specific mutations

• Creation of knock-in mouse models with reporter-tagged Olfr13

• Development of inducible systems for temporal control of Olfr13 expression