Recombinant Mouse Olfactory receptor 142 (Olfr142)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Olfr142; Mor227-2; Olfr4; Olfactory receptor 142; Olfactory receptor 227-2; Olfactory receptor 4C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-305
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Olfr142
Target Protein Sequence
MANKNNVTELIFTGLFQDPEVQKVCFVLFLPVYLATLLGNSLILVAVSISKTLHSPMYFF LSSLSLVEICYSSTIVPKFITDLLAKVKTISLKGCLTQIFFSHFFGVVEVILLVVMAYDR YVAICKPLHYMNIMSRQVCHMLVAGSWLGGFIHSIIQIIITIPLPFCGPNVIDHYFCDLQ QLFKLACTDTFMEGFIVMANSGLISIVSLFILVSSYAVILISLRKRSAEGRRKALSTCAS HITVVILFFVPGAFIYMRPSSTFTEDKLVSVFYTVITPMLNPIVYTLRNTEMKNAIRMSW KQKDS
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Olfr142 and how does it function within the mouse olfactory system?

Olfr142 is one of approximately 1,200 olfactory receptors in the mouse genome that belongs to the G protein-coupled receptor (GPCR) family. Like other ORs, Olfr142 likely plays dual roles in odorant detection and axon guidance within the olfactory system . When expressed in olfactory sensory neurons, these receptors detect specific odorant molecules, initiating a signal transduction cascade that ultimately leads to odor perception. The molecular basis of OR-mediated signal detection involves recognition of structurally diverse odorant molecules and subsequent activation of G proteins that increase intracellular cAMP levels . Olfactory receptors also guide axons to specific glomeruli in the olfactory bulb, contributing to the spatial mapping of odor information .

Where is Olfr142 typically expressed in mouse tissues?

While the search results don't specifically mention Olfr142's expression pattern, studies on other mouse ORs indicate that expression can extend beyond the olfactory epithelium. For example, several ORs (Olfr56, Olfr90, Olfr558, Olfr461, Olfr1033, Olfr1034, and Olfr1396) have been detected in kidneys and other non-olfactory tissues including liver, lung, heart, skeletal muscle, stomach, testes, and uterus . Each OR exhibits a unique tissue expression profile. To determine Olfr142's expression pattern, RT-PCR screening using gene-specific primers designed to amplify unique sequences of Olfr142 could be performed across multiple tissues, similar to methodologies described for other ORs .

What are the structural characteristics of Olfr142?

As a member of the OR family, Olfr142 likely shares the characteristic seven-transmembrane domain structure common to GPCRs. The receptor would contain an extracellular N-terminus, seven membrane-spanning helices connected by intra- and extracellular loops, and an intracellular C-terminus. The binding pocket for odorants is typically formed by the transmembrane domains, with specific amino acid residues determining ligand specificity. For detailed structural information about Olfr142 specifically, molecular modeling based on homology to other characterized ORs or crystallographic studies would be necessary, as structural determination of ORs has been historically challenging due to difficulties in expressing and purifying these membrane proteins in sufficient quantities .

What are the optimal methods for recombinant expression of Olfr142?

Recombinant expression of ORs presents significant challenges due to their poor trafficking to the cell surface. Based on approaches used for other mouse ORs, several strategies could be employed for successful expression of Olfr142:

  • Expression System Selection: Transiently transfected mammalian cells (such as HEK-293T) have proven successful for OR expression .

  • Vector and Tag Optimization: Inclusion of specific tags can enhance expression and detection:

    • C-terminal fusion with green fluorescent protein (GFP) allows quantification of total cellular OR biosynthesis

    • N-terminal tags like Lucy-Flag-Rho improve trafficking to the cell surface

    • Post-translational fluorescence labeling of an N-terminal peptide sequence enables selective visualization of membrane-localized receptors

  • Co-expression with Chaperones: Receptor transporting protein 1S (RTP1S) significantly improves surface expression of ORs .

  • Quantification Methods: Cell flow cytometry can be used to quantify surface expression levels, with successful expression yielding approximately 10^6 receptors per cell in optimized systems .

For Olfr142 specifically, a dual-color labeling approach combining these strategies would likely provide the best results, allowing differentiation between total expression and functional surface expression .

How can I identify and validate ligands for Olfr142?

Ligand identification for Olfr142 would require a systematic screening approach similar to that used for other ORs:

  • Prerequisite: Ensure sufficient surface expression of the receptor using immunocytochemistry to visualize surface-localized receptors. A "chicken wire-like" staining pattern in >25% of expressing cells typically indicates sufficient surface expression for ligand screening .

  • Luciferase Reporter Assay: This assay leverages the fact that ORs are GPCRs that couple to stimulatory G proteins, elevating intracellular cAMP upon activation. A firefly luciferase reporter under control of a cAMP response element can be used to detect receptor activation, with a constitutively active Renilla luciferase serving as an internal control for normalization .

  • Compound Library Selection: For Olfr142, consider screening:

    • Broadly activating odorants from chemical screening libraries

    • Compounds that activate phylogenetically related ORs in the same subfamily

    • Molecules classified as odorants present in biological fluids

    • Metabolites produced by commensal or environmental microorganisms

  • Dose-Response Analysis: Once potential ligands are identified, dose-response curves should be generated to determine EC50 values and relative potencies .

  • Specificity Testing: Test identified compounds on cells expressing irrelevant receptors or empty vector controls to confirm specificity .

What are the challenges in achieving functional surface expression of Olfr142?

ORs typically exhibit poor trafficking to the cell surface when heterologously expressed, which presents a major barrier to functional studies. For example, two of seven ORs studied (Olfr1033 and Olfr56) showed relatively poor surface expression despite optimization attempts . Several factors may contribute to this challenge with Olfr142:

  • Protein Misfolding: ORs may fail to achieve proper folding in heterologous systems.

  • ER Retention: Misfolded ORs are often retained in the endoplasmic reticulum.

  • Lack of Olfactory-Specific Factors: Heterologous cells may lack specific factors present in olfactory sensory neurons that facilitate proper folding and trafficking.

  • Receptor-Specific Sequences: Unique amino acid sequences within Olfr142 may affect its ability to traffic to the surface.

To overcome these challenges, researchers should consider:

  • Co-expression with chaperone proteins like RTP1S

  • Addition of N-terminal tags (Lucy tag, Rho tag)

  • Testing multiple cell lines for expression

  • Creating chimeric receptors that incorporate well-trafficking domains from other GPCRs

  • Optimizing codons for the expression system

Success in surface expression should be quantitatively assessed using fluorescence-based assays, with at least 25% of expressing cells showing characteristic surface staining patterns .

How should I design RT-PCR experiments to detect endogenous Olfr142 expression?

To detect endogenous Olfr142 expression in various tissues, consider the following approach:

  • Primer Design:

    • Design gene-specific primers targeting unique regions of Olfr142

    • Aim for amplicons of 100-600 bases that encompass sequences unique to Olfr142

    • Validate primer specificity in silico to avoid cross-reactivity with other ORs

  • RNA Isolation and Quality Control:

    • Harvest tissues and immediately flash-freeze in liquid nitrogen

    • Homogenize tissues in TRIzol using appropriate lysing matrices

    • For fibrous tissues like heart, use specialized lysing matrices (e.g., Matrix SS)

    • Perform multiple homogenization cycles (e.g., 3 runs at 6.0 m/s for 40 s) with cooling between runs

  • Reverse Transcription and PCR:

    • Use high-quality reverse transcriptase to generate cDNA

    • Include appropriate positive controls (tissues known to express ORs) and negative controls

    • For potentially low-abundance transcripts, consider increasing the amount of cDNA template in PCR reactions

  • Validation:

    • Gel-extract and sequence any amplified bands to confirm specificity

    • Repeat experiments with multiple biological replicates (n≥4)

    • Consider both male and female animals to identify potential sex differences in expression patterns

What analytical techniques are most effective for studying Olfr142 signaling mechanisms?

Multiple complementary techniques can be employed to study Olfr142 signaling:

  • cAMP Assays:

    • Luciferase reporter assays using CRE-luciferase constructs measure cAMP elevations upon receptor activation

    • FRET-based sensors can provide real-time monitoring of cAMP dynamics

    • Direct measurement of cAMP using ELISA or radioimmunoassay provides quantitative data

  • Calcium Imaging:

    • Calcium indicators (Fura-2, Fluo-4, or genetically encoded indicators) can detect calcium transients following receptor activation

    • This approach allows for assessment of single-cell responses and temporal dynamics

  • Electrophysiology:

    • Patch-clamp recordings from Olfr142-expressing cells can directly measure electrical responses

    • This technique provides high temporal resolution of signaling events

  • Protein-Protein Interaction Studies:

    • Co-immunoprecipitation can identify G proteins and other signaling partners

    • BRET or FRET approaches can detect real-time interactions between Olfr142 and signaling components

  • Phosphorylation Studies:

    • Phospho-specific antibodies or mass spectrometry can track receptor phosphorylation following activation

    • Western blotting for phosphorylated downstream effectors can map signaling cascades

These techniques should be performed with appropriate controls, including cells expressing empty vectors and cells treated with vehicle alone to account for non-specific effects .

How can I validate antibodies for detecting Olfr142 in tissue samples?

Antibody validation is critical for reliable detection of Olfr142 in tissue samples:

  • Antibody Selection:

    • Choose antibodies targeting unique regions of Olfr142 to avoid cross-reactivity with other ORs

    • Consider generating custom antibodies if commercial options lack specificity

  • Validation in Recombinant Systems:

    • Test antibodies on cells transfected with tagged Olfr142 constructs

    • Compare staining patterns with tag-specific antibodies or fluorescent protein fusion signals

    • Include cells expressing related ORs to assess cross-reactivity

  • Knockout/Knockdown Controls:

    • Use tissues from Olfr142-knockout mice as negative controls if available

    • Alternatively, employ siRNA knockdown in cell systems expressing Olfr142

  • Peptide Competition Assays:

    • Pre-incubate antibodies with immunizing peptides to confirm binding specificity

    • Signal should be significantly reduced in the presence of specific competing peptides

  • Western Blotting Validation:

    • Confirm antibody detects a band of appropriate molecular weight

    • Include positive controls (recombinant Olfr142) and negative controls

    • Consider deglycosylation experiments to account for post-translational modifications

  • Immunohistochemistry Controls:

    • Include secondary-only controls to assess non-specific binding

    • Use tissue known to express or not express Olfr142 based on RT-PCR results

How do I interpret inconsistent ligand responses with Olfr142?

When encountering inconsistent responses to potential Olfr142 ligands, consider multiple factors:

  • Receptor Expression Levels:

    • Variations in surface expression between experiments can affect response magnitude

    • Quantify receptor expression in each experiment using flow cytometry or imaging approaches

  • Compound Properties:

    • Volatile compounds may have variable effective concentrations due to evaporation

    • Hydrophobic compounds may precipitate or adhere to plasticware

    • Some compounds may have limited solubility in assay buffers

    • Consider using sealed plates and consistent incubation times

  • Experimental Variables:

    • Temperature fluctuations can affect receptor-ligand interactions

    • Cell density and passage number may influence receptor functionality

    • Standardize all experimental conditions across replicates

  • Data Normalization:

    • Use appropriate internal controls (e.g., Renilla luciferase) for normalization

    • Include positive control ligands with known efficacy in each experiment

    • Consider normalizing to maximum receptor response rather than absolute values

  • Statistical Analysis:

    • Apply appropriate statistical tests that account for day-to-day variability

    • Consider using mixed-effects models that incorporate experimental batch as a random effect

    • Determine if inconsistencies reflect true receptor properties or technical variability

For example, in studies with Olfr558, researchers observed robust activation with butyric acid but inconsistent responses to nonanoic acid, suggesting genuine differences in ligand efficacy rather than technical issues .

What is the significance of finding Olfr142 expressed in non-olfactory tissues?

If Olfr142 is found in non-olfactory tissues, several interpretations should be considered:

  • Physiological Functions:

    • ORs in kidney may participate in chemosensing or renal physiological processes

    • Expression in other tissues suggests potential roles in tissue-specific chemical detection

    • The receptor may respond to endogenous ligands rather than environmental odorants

  • Evolutionary Significance:

    • Wide distribution may reflect ancient chemosensory roles predating specialized olfaction

    • Tissue-specific expression patterns might reveal evolutionary adaptation of receptor function

  • Clinical Relevance:

    • Altered expression in disease states could indicate potential as biomarkers

    • Understanding non-canonical functions could reveal therapeutic targets

  • Methodological Considerations:

    • Validate findings using multiple detection methods (RT-PCR, RNA-seq, immunohistochemistry)

    • Quantify relative expression levels compared to olfactory epithelium

    • Confirm functionality through tissue-specific signaling assays

Research on other ORs has shown unique tissue distribution profiles, with some receptors expressed in multiple non-olfactory tissues. For example, all seven ORs in one study were detected in kidney, but each showed a distinct expression pattern across other tissues, suggesting tissue-specific functions rather than random expression .

How can I use CRISPR-Cas9 to generate Olfr142 knockout mice for functional studies?

Generating Olfr142 knockout mice using CRISPR-Cas9 requires careful planning:

  • Guide RNA Design:

    • Design multiple sgRNAs targeting exonic regions of Olfr142

    • Avoid sequences with potential off-target effects elsewhere in the genome

    • Consider targeting critical functional domains for complete loss-of-function

  • Delivery Method:

    • Microinjection of Cas9 protein and sgRNAs into zygotes offers efficient editing

    • Alternatively, deliver as plasmids or mRNAs depending on experimental needs

  • Genotyping Strategy:

    • Design PCR primers flanking the targeted region

    • Consider restriction enzyme digestion-based screening if edit creates or destroys a restriction site

    • Sequence PCR products to confirm mutations and determine their nature

  • Validation:

    • Confirm absence of Olfr142 mRNA expression using RT-PCR

    • Validate protein loss using validated antibodies if available

    • Assess whether compensatory upregulation of other ORs occurs

  • Phenotypic Analysis:

    • Behavioral assays to assess olfactory function

    • If expressed in non-olfactory tissues, evaluate relevant physiological parameters

    • Consider both homozygous and heterozygous animals to assess gene dosage effects

  • Controls:

    • Generate and maintain appropriate wild-type littermate controls

    • Consider creating control lines with non-targeting sgRNAs to account for Cas9 effects

What approaches can be used to identify intracellular signaling partners of Olfr142?

Multiple complementary approaches can identify Olfr142 signaling partners:

  • Proteomics-Based Methods:

    • Immunoprecipitation followed by mass spectrometry to identify interacting proteins

    • Proximity labeling techniques (BioID, APEX) to capture transient interactions

    • SILAC or TMT labeling for quantitative comparison of stimulus-dependent interactions

  • Functional Screening:

    • siRNA screens targeting G proteins, arrestins, and other GPCR-interacting proteins

    • Overexpression screens with dominant-negative mutants of signaling components

    • Pharmacological inhibitor screening to identify signaling pathways

  • Live-Cell Interaction Assays:

    • BRET/FRET assays to detect direct protein-protein interactions

    • Split-luciferase complementation assays for confirming binary interactions

    • Single-molecule imaging to track receptor dynamics and clustering

  • Computational Approaches:

    • Molecular docking to predict interactions with G proteins and other partners

    • Network analysis based on known interactors of related ORs

    • Structural modeling to identify potential interaction interfaces

  • In Vivo Validation:

    • Conditional knockout or knockdown of identified partners in relevant tissues

    • Phospho-proteomics to map signaling cascades activated upon receptor stimulation

    • Tissue-specific reporter assays to confirm pathway activation

These approaches should be applied in appropriate cellular contexts, considering that signaling partners may differ between olfactory and non-olfactory tissues where Olfr142 might be expressed.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.