Recombinant Mouse Olfactory receptor 1444 (Olfr1444)

Shipped with Ice Packs
In Stock

Description

Functional Role and Odorant Responsiveness

Olfr1444 is part of the largest gene family in mammals, responsible for detecting volatile odor molecules. While its specific ligands remain understudied, comparative analyses suggest it may share functional similarities with other olfactory receptors (ORs) that respond to aliphatic acids or aromatic compounds .

Experimental Insights

  • Odorant Sensitivity: In vivo studies using phosphorylated ribosome profiling identified Olfr1444 as part of the repertoire activated by acetophenone, though its sensitivity thresholds require further validation .

  • Tissue Expression: RT-PCR and RNA-seq data confirm OLFR1444 mRNA in the cornea, suggesting potential roles beyond olfaction, such as ocular chemosensation .

Research Applications and Detection Methods

Recombinant Olfr1444 is primarily used in structural and functional studies, including:

  1. ELISA Kits: Quantitative detection of Olfr1444 in biological fluids (serum, plasma, tissue homogenates) with a detection range of 15.6–1000 pg/mL .

  2. Heterologous Expression: Co-expression with accessory proteins (e.g., RTP1, Gαolf) enhances membrane trafficking in mammalian cells, critical for functional assays .

Comparative Analysis of Detection Methods

MethodSensitivitySample TypeApplications
ELISA9.375 pg/mLSerum, plasma, tissuesQuantitative analysis of Olfr1444 levels
Recombinant Protein≥85% purityIn vitro assaysLigand binding, structural studies

Challenges and Future Directions

  • Limited Ligand Data: Unlike well-characterized ORs (e.g., MOR23-1), Olfr1444’s odorant specificity remains undefined .

  • Expression Optimization: Recombinant production often requires chaperones (e.g., RTP1) to enhance membrane localization, a hurdle for high-throughput studies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please specify it in your order remarks. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend centrifuging the vial briefly prior to opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%. You may use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us and we will prioritize development according to your specification.
Synonyms
Olfr1444; Mor202-4; Olfactory receptor 1444; Olfactory receptor 202-4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-319
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Olfr1444
Target Protein Sequence
MTSMENITEVTEFILLGLTDDPNLQVPLLLIFLFIYLVTLIGNGGMMVIIFSDSHLHTPM YFFLSNLSFVDLGYSSAVAPKMVAALQSGNKVISYNGCAAQFFFFVGFATVECYLLASMA YDRHAAVCRPLHYTTTMTTGVCTILTIGSYTCGFLNASIHAADTFKLSFCGSNKINHFFC DIPPLLALACSSTHISKLVVFFVVGFNVFFTLLVIIISYFFIYIAIQNMKSSEGRKKAFS TCASHLTAVSIFYGTIIFMYLQPSSGQSMDTDKIASVFYTVVIPMLNPLIYSLRNREVKS ALWKILNRFYPASFSVSRK
Uniprot No.

Target Background

Function
Potential odorant receptor.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Olfactory receptor 1444 (Olfr1444)?

Olfactory receptor 1444 (Olfr1444) is a G protein-coupled receptor (GPCR) expressed in mouse olfactory sensory neurons (OSNs) and potentially in other tissues. It belongs to the large family of olfactory receptors that mediate the detection of odorants. Olfr1444 is also known by its alternative name Olfactory receptor 202-4 (Mor202-4), with UniProt accession number Q8VFX2 . Like other olfactory receptors, it likely plays a role in the initial steps of olfactory signal transduction, converting chemical detection of odorants into neuronal signals.

How does Olfr1444 expression compare to other olfactory receptors?

Olfactory receptors show highly regulated expression patterns. While specific data for Olfr1444 expression levels aren't provided in the search results, research on olfactory receptors generally indicates that:

  • Each olfactory sensory neuron typically expresses a single OR gene from a pool of hundreds .

  • OR gene expression can be influenced by accessory proteins such as RTP1 and RTP2, which affect OR trafficking and stability .

  • The relative abundance of OR transcripts is conserved between individual animals, as evidenced by transcriptomic studies showing a mean pairwise Spearman's rho of 0.83 (P < 2.2 × 10^-16) between biological replicates .

Understanding Olfr1444's expression relative to other ORs would require specific profiling studies targeting this receptor.

What methods are recommended for studying Olfr1444 expression in tissues?

Several complementary approaches can be used to study Olfr1444 expression:

  • RT-PCR: This technique can confirm Olfr1444 expression in different tissues. When designing primers, researchers should consider whether Olfr1444 is encoded by a single exon or multiple exons. For single-exon genes, controls without reverse transcription should be included to eliminate genomic DNA contamination as a source of false positives .

  • RNA in situ hybridization: This approach can visualize the spatial distribution of Olfr1444-expressing cells within tissues. Probes specific to Olfr1444 can be designed to quantify the number of cells expressing this receptor in different experimental conditions .

  • Next-Generation Sequencing (NGS): For comprehensive profiling, RNA-seq can identify and quantify Olfr1444 transcripts. Targeted capture approaches have been shown to enrich ORs and related transcripts in a highly consistent fashion, with technical replicate correlations of Spearman's rho of 0.95 (P < 2.2 × 10^-16) .

  • Immunostaining: Antibodies against Olfr1444 can be used to detect protein expression and localization, particularly important for tracking receptor trafficking to dendrites versus retention in cell bodies .

How can researchers produce recombinant Olfr1444 protein for experimental use?

Production of functional recombinant Olfr1444 requires careful consideration of the following factors:

  • Expression System Selection: Mammalian expression systems are often preferred for GPCRs to ensure proper folding and post-translational modifications. HEK293 cells are commonly used for OR expression .

  • Co-expression with Accessory Proteins: Research indicates that RTP1 and RTP2 are crucial for OR trafficking to the cell surface. Co-expression of these accessory proteins significantly improves surface expression of ORs in heterologous systems .

  • Protein Purification: For biochemical studies, recombinant Olfr1444 can be produced with affinity tags for purification. The storage buffer typically includes Tris-based buffer with 50% glycerol, optimized for protein stability .

  • Quality Control: Verification of proper folding and functionality through ligand binding assays is essential, as ORs are notoriously difficult to express in functional form outside their native environment.

  • Storage Considerations: Recombinant Olfr1444 should be stored at -20°C, with extended storage at -80°C. Repeated freeze-thaw cycles should be avoided, and working aliquots can be stored at 4°C for up to one week .

What techniques can assess Olfr1444 trafficking and localization?

Proper trafficking of olfactory receptors is critical for their function. Several approaches can be used to study Olfr1444 trafficking:

  • Immunostaining with Confocal Microscopy: This approach can visualize receptor localization within cells. Studies with other ORs have shown that in the absence of RTP1 and RTP2, ORs remain restricted to the cell body rather than trafficking to dendrites .

  • GFP-Tagging: Fusion of Olfr1444 with fluorescent proteins like GFP can allow live-cell imaging of receptor trafficking. This approach has been used with other ORs (e.g., Olfr151/M71) to track their movement within neurons .

  • Quantitative Analysis of Receptor Localization: Measurement of fluorescence intensity in different cellular compartments can provide quantitative assessment of trafficking efficiency. For example, comparison of dendrite versus cell body localization can be analyzed statistically .

  • Cell Surface Biotinylation: This biochemical approach can quantify the proportion of Olfr1444 that reaches the cell surface, providing a complementary method to imaging approaches.

How does RTP1/2 impact Olfr1444 trafficking and function?

While specific data for Olfr1444 is not provided, research on other olfactory receptors reveals that RTP1 and RTP2 are critical for OR trafficking:

  • Trafficking Mediation: RTP1 and RTP2 promote cell surface expression of ORs in heterologous expression systems . In RTP1,2 double knockout (RTP1,2DKO) mice, ORs like Olfr151 fail to traffic to dendrites and remain restricted to the cell body .

  • Differential Effects on ORs: Loss of RTP1 and RTP2 affects ORs differentially. Transcriptomic analysis of RTP1,2DKO mice showed:

    • 562/1088 (51.7%) of OR transcripts were downregulated

    • 116/1088 (10.7%) of OR transcripts were upregulated

    • When normalizing for reads mapped to intact ORs, 503/1088 were underrepresented and 175/1088 were overrepresented

  • Impact on OR Stability: RTP1 and RTP2 appear linked to stable OR gene choice. Their absence leads to increased expression of nATF5, suggesting unstable OR gene expression in affected neurons .

Researchers studying Olfr1444 should determine whether it belongs to the category of RTP1/2-dependent ORs or if it can traffic independently of these accessory proteins.

What experimental models can best investigate Olfr1444 function in non-olfactory tissues?

Recent research has identified olfactory receptors in unexpected tissues, suggesting broader physiological roles:

  • Tissue-Specific Expression Analysis: Several approaches have identified ORs in non-olfactory tissues:

    • RT-PCR confirmation of OR expression in mouse cornea and other parts of the eye

    • Detection of OR activity in pancreatic islets, with 300 OR genes expressed in islets and 66 upregulated in NOD mouse islets at 4 weeks of age

  • Functional Studies in Relevant Cell Lines: For investigating potential roles of Olfr1444 in specific tissues:

    • Cell lines derived from tissues where Olfr1444 is expressed can be used for functional studies

    • CRISPR-Cas9 knockout or overexpression systems can help establish causal relationships

    • Calcium imaging or cAMP assays can be used to assess signaling outcomes

  • Tissue-Specific Conditional Knockout Models: Generation of conditional knockout mice where Olfr1444 is specifically deleted in non-olfactory tissues of interest can help elucidate tissue-specific functions.

  • Organoid Models: Three-dimensional culture systems that recapitulate tissue architecture may be valuable for studying Olfr1444 in a more physiologically relevant context than traditional cell cultures.

How can researchers analyze Olfr1444's role in metabolic processes?

Recent research suggests potential roles for olfactory receptors in metabolic regulation:

  • Pancreatic Islet Studies: Evidence suggests ORs may regulate hormonal secretion:

    • Olfr544 has been shown to regulate glucagon secretion

    • Olfr821 and Olfr15 may regulate insulin secretion

    • 66 ORs were upregulated in NOD mouse islets at 4 weeks of age, suggesting possible roles in diabetes pathophysiology

  • Experimental Approaches:

    • Glucose-stimulated insulin secretion assays in the presence of Olfr1444 agonists/antagonists

    • Metabolic phenotyping of Olfr1444 knockout mice (glucose tolerance tests, insulin sensitivity)

    • Ex vivo islet perifusion studies to assess dynamic hormone secretion

  • Potential Mediators: Investigation of downstream signaling pathways specific to Olfr1444 activation in metabolic tissues could identify novel therapeutic targets.

What are common challenges in expressing functional Olfr1444 and how can they be addressed?

Expressing functional olfactory receptors presents several challenges:

  • Poor Surface Trafficking: ORs often fail to reach the cell surface in heterologous systems.

    • Solution: Co-express RTP1, RTP2, and other accessory proteins to enhance trafficking

    • Validation: Compare immunostaining patterns with and without accessory proteins

  • Protein Misfolding and Aggregation: ORs may form aggregates in the endoplasmic reticulum.

    • Solution: Optimize expression conditions (temperature, inducer concentration)

    • Validation: Assess protein solubility through western blotting of different cellular fractions

  • Low Expression Levels: Many ORs show limited expression in heterologous systems.

    • Solution: Use codon-optimized sequences and strong promoters

    • Validation: Quantify expression using qPCR and western blotting

  • Functional Validation Challenges: Confirming ligand responses can be difficult.

    • Solution: Use multiple complementary functional assays (calcium imaging, cAMP assays)

    • Validation: Include positive controls (ORs with known ligands) and negative controls

How should contradictory data about Olfr1444 function be interpreted?

When facing contradictory results regarding Olfr1444 function, consider:

  • Expression System Differences: Results may vary based on the cellular context of expression.

    • Analysis: Compare methodological details across studies, particularly expression systems

    • Resolution: Perform side-by-side comparisons in multiple systems

  • Accessory Protein Variability: Different levels of RTP1/2 and other accessory proteins can affect OR function.

    • Analysis: Check for co-expression of accessory proteins in contradictory studies

    • Resolution: Standardize accessory protein expression levels

  • Genetic Background Effects: In mouse models, genetic background can influence OR expression patterns.

    • Analysis: Compare the genetic background of mouse models used in different studies

    • Resolution: Backcross to a common genetic background for direct comparison

  • Technical Variability in Detection Methods: Different assays may have varying sensitivity.

    • Analysis: Evaluate detection thresholds and potential for false positives/negatives

    • Resolution: Employ multiple complementary detection methods

What emerging technologies might enhance Olfr1444 research?

Several technological advances hold promise for advancing Olfr1444 research:

  • Single-Cell Transcriptomics: This approach can reveal cell-type specific expression patterns of Olfr1444 across tissues.

    • Current targeted capture approaches for ORs show high technical replicate correlation (Spearman's rho of 0.95)

    • This could be extended to single-cell resolution to understand cellular heterogeneity

  • CRISPR-Based Screening: Genome-wide CRISPR screens can identify genes that modulate Olfr1444 expression and function.

    • Screens could reveal novel accessory proteins beyond RTP1/2

    • Potential to identify tissue-specific regulators in non-olfactory contexts

  • Cryo-EM and Structural Biology: Advances in membrane protein structural biology may enable determination of Olfr1444's structure.

    • Structure could inform rational design of selective ligands

    • Molecular dynamics simulations could predict binding interactions

  • Spatial Transcriptomics: This technology could map Olfr1444 expression within complex tissues with spatial context.

    • Current decoding of the olfactory map through targeted transcriptomics has mapped 86% of ORs across the olfactory bulb

    • Spatial methods could extend this to non-olfactory tissues

How might Olfr1444 be involved in disease processes based on current knowledge?

Emerging evidence suggests potential roles for olfactory receptors in disease:

  • Metabolic Disorders: Several ORs have been implicated in metabolic regulation:

    • 66 OR genes were upregulated in NOD mouse islets at 4 weeks of age, a model for type 1 diabetes

    • Specific ORs like Olfr544, Olfr821, and Olfr15 may regulate hormonal secretion in pancreatic islets

  • Sensory Disorders: Beyond their canonical role in olfaction, ORs like Olfr1444 might contribute to:

    • Chemosensory deficits in various neurological conditions

    • Altered sensory perception in metabolic disorders

  • Developmental Processes: The temporal regulation of OR expression suggests potential roles in development:

    • Comparisons of OR expression in OMP-positive layers from wild-type and RTP1,2DKO mice showed significant differences at 1 day and 21 days but not at 6 months

    • This temporal pattern suggests critical developmental windows for OR function

Understanding whether Olfr1444 contributes to these processes will require specific studies targeting this receptor in relevant disease models.

What controls are essential when studying Olfr1444 expression?

To ensure robust and reproducible results when studying Olfr1444, researchers should implement the following controls:

  • RT-PCR Controls:

    • No-RT controls are crucial, especially for single-exon OR genes, to rule out genomic DNA contamination

    • For Olfr1444 specifically, designing primers across exon-exon junctions (if applicable) can distinguish between genomic and transcribed sequences

    • Include positive control tissues with known Olfr1444 expression

  • Expression System Controls:

    • When expressing Olfr1444 recombinantly, include both positive controls (ORs known to express well) and negative controls (empty vector)

    • Expression with and without accessory proteins like RTP1/2 can help assess trafficking dependency

  • Antibody Validation:

    • For immunostaining studies, validate antibody specificity using Olfr1444 knockout tissues or cells

    • Include peptide competition assays to confirm binding specificity

  • Functional Assay Controls:

    • Include dose-response curves with known OR ligands as positive controls

    • Test for non-specific effects using cells lacking Olfr1444 expression

What standardized protocols should be established for Olfr1444 research?

Standardization of key protocols would enhance reproducibility in Olfr1444 research:

  • Expression and Purification Protocol:

    • Standardized production of recombinant Olfr1444 with defined purity criteria

    • Consistent storage conditions: Tris-based buffer with 50% glycerol at -20°C or -80°C

    • Quality control metrics for functional validation

  • Trafficking Assessment:

    • Quantitative measures of subcellular localization (e.g., dendrite vs. cell body ratio)

    • Standardized imaging parameters for comparing wild-type and mutant forms

  • Ligand Screening Approach:

    • Consistent assay formats for identifying potential ligands

    • Standard positive and negative controls for comparative analysis

    • Defined criteria for what constitutes a "hit" in screening assays

Establishing these standards would facilitate data comparison across different studies and accelerate progress in understanding Olfr1444 function.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.