Recombinant Mouse Olfactory receptor 145 (Olfr145)
Shipped with Ice Packs 
In Stock 
Description
Production and Stability
Expression Systems
-
Bacterial: E. coli-derived variants (e.g., CSB-EP726681MO1-B) dominate due to cost efficiency
-
Yeast: Alternative systems (e.g., CSB-YP726681MO1) for eukaryotic post-translational modifications
-
Reconstitution: Requires deionized water + 5–50% glycerol for solubility
Stability Parameters
Functional Insights from Research
Key Findings
-
Spontaneous Activity Regulation:
-
Gene Expression Control:
-
Spatial Organization:
Experimental Applications
Primary Uses
Product Specs
Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will fulfill your request as best as possible.
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will fulfill your request as best as possible.
Lead Time
Delivery time
may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Olfr145; Mor161-6; Olfr7; Olfactory receptor 145; Odorant receptor K21; Olfactory receptor 161-6; Olfactory receptor 7C
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Olfr145
Target Protein Sequence
MATENASVPEFILAGLTDQPGLRMPLFFLFLGFYMVTMVGNLGLITLIGLNSHLHTPMYF
FLFNLSLIDFCYSTVITPKMLVSFVSKKNIISYSGCMTQLFFFLFFVVSESFILSAMAYD
RYVAICNPLMYTVTMSPQVCLLLLLGVYVMGFAGAMAHTAFMVKLTFCADKLVNHYMCDI
LPLLERSCTSTYVNELVVFIVVGIDIGVPTVTIFISYALILSSILRISSTEGRSKAFSTC
SSHIIAVSLFFGSGAFMYLKPSSLLPMNQGKVSSLFYTIVVPMLNPLIYSLRNKDVKVAL
RKTLSRSSFS
Uniprot No.
Target Background
Function
Odorant receptor.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
