Recombinant Mouse Olfactory receptor 146 (Olfr146)

Shipped with Ice Packs
In Stock

Description

Recombinant Expression Systems

Recombinant Olfr146 is produced using multiple expression platforms to study its structure and function:

Expression SystemHost SpeciesTagPurityApplicationSource
Mammalian Cells (HEK293)MouseHis, Fc-Avi>80%Ligand screening, assaysCreative BioMart
E. coliMus musculusHis (full-length)N/AStructural studiesLabomics

Key advancements include:

  • Dual fluorescent labeling: Enabled quantification of plasma membrane localization in HEK293 cells .

  • Functional yield: Achieved up to 10⁶ receptors per cell in transient transfection systems .

Functional and Odorant Response Profiles

Odorant screening assays reveal Olfr146’s broad ligand specificity:

Key Findings:

  • Broad responsiveness: Native OSNs expressing Olfr146 respond to >50 odorants, including aldehydes, ketones, and esters .

  • Electrophysiological activity: Exhibits higher sensitivity to aldehydes (e.g., hexanal) compared to other odorant classes .

  • Strain-dependent variation: OSN abundance varies between mouse strains (e.g., C57BL/6J vs. 129S6/SvEvTac) .

Comparison with other MOR256-family receptors:

ReceptorExpression SystemOdorant Response BreadthKey Ligands
Olfr146Native OSNs, HEK293Broad (>50 compounds)Hexanal, Heptanal
SR1 (Olfr124)Native OSNsModerate (~30 compounds)Acetophenone, Eugenol

Pathway Involvement and Genetic Regulation

Olfr146 participates in olfactory transduction, interacting with proteins like adenylate cyclase type 3 (ADCY3) and olfactory marker protein (OMP) . Key regulatory mechanisms include:

  • Enhancer cooperativity: Transcription factors Ebf and Lhx2 bind enhancers to evade heterochromatic silencing .

  • Zonal expression: Localizes to dorsoventral regions of the olfactory bulb, correlating with odorant receptor sequence .

Challenges and Future Directions

  • Low native expression: Requires amplification via RNA-seq or targeted capture sequencing for detection .

  • Structural studies: Nanodisc or micelle systems may improve stability for cryo-EM analyses .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
Olfr146; Mor171-10; Olfr7; Olfactory receptor 146; Odorant receptor M15; Olfactory receptor 171-10; Olfactory receptor 7D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-306
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Olfr146
Target Protein Sequence
MEKGNQSTVNKFFLSGLTEQPELQLPLFLLFLGIYLLTVLGNLGMIILILLSSYLHTPMY FFLSSLSFIDFCQSTVITPKMLVKFVREKNEISYPECITQLCFFVIFAVSESYMLAAMAY DRYVAICSPLLYSSIMSQHKCLSLVLGVYILGIVCASAHVGCIFRIDFCKSDLINHYFCD LISILNLSCSNIFVNDLVILIFSLINTIFPTLTILSSYAFIIISILRIKSTEGRSKAFST CSSHISAVAIFYISAGFTYLNPSSSHSMDEGKVSSIFYTIIVPMLNPLIYSLRNKDVKIA LKKMIE
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Olfr146 and how does it function in the olfactory system?

Olfr146 belongs to the large family of G protein-coupled odorant receptors expressed in olfactory sensory neurons (OSNs) of mice. Like other ORs, Olfr146 functions through a signaling cascade that begins with odorant binding, which activates the G protein Golf, leading to adenylyl cyclase 3 (AC3) activation and subsequent cAMP production. This increase in cAMP opens cyclic nucleotide-gated channels, resulting in calcium influx and ultimately generating action potentials that transmit odor information to the brain .

The specific recognition profile of Olfr146 contributes to the broader combinatorial coding scheme where each OR can be activated by multiple odorants, and each odorant can activate multiple ORs, creating a unique activation pattern for different odors. According to this combinatorial coding principle, the brain interprets specific combinations of activated ORs as distinct odor perceptions .

How does Olfr146 expression compare to other olfactory receptors in mice?

Olfr146 follows the "one neuron-one receptor" rule characteristic of the main olfactory system, where each OSN typically expresses only one OR gene out of the approximately 1,000 OR genes in mice . The expression pattern of Olfr146 is distributed throughout the olfactory epithelium, similar to other ORs.

While the search results don't provide specific expression data for Olfr146, studies of other ORs indicate that typically only 0.1-1% of the total OSN population expresses any given OR. Expression levels can be affected by developmental factors and environmental conditions. For context, studies of other ORs like mOR256-17 have shown that genetic modifications (such as in β3GnT2−/− mice) can alter expression patterns, with some receptors showing increases or decreases in expression of up to 60-75% .

What are the known ligands for Olfr146?

Recent advances in machine learning approaches have enabled screening of approximately 0.5 million compounds to identify potential ligands for various ORs . These computational approaches can identify structural motifs enriched in ligands for specific receptors, which could be applied to identify Olfr146 ligands.

What expression systems are most effective for studying recombinant Olfr146?

For successful functional expression of recombinant Olfr146, heterologous expression systems like Human Embryonic Kidney (HEK) cells, particularly the specialized Hana3A cell line, are recommended. The Hana3A cell line has been engineered to stably express Golf, REEP1, RTP1, and RTP2, which are crucial for proper OR trafficking and functionality .

To optimize expression, researchers should:

  • Use an N-terminal tag (such as a shortened rhodopsin sequence, "Rho-tag") to improve surface expression

  • Co-express receptor-transporting proteins, particularly RTP1S (a shorter version of RTP1 that shows enhanced effectiveness)

  • Include appropriate accessory proteins in the expression system

These modifications collectively enhance the trafficking of ORs to the cell membrane, overcoming one of the primary challenges in OR research—poor heterologous expression .

What are the most reliable methods for monitoring Olfr146 activation in vitro?

Several methodologies exist for monitoring OR activation, with the GloSensor cAMP assay emerging as particularly effective for real-time monitoring:

  • GloSensor cAMP assay: This luminescence-based method allows real-time monitoring of OR activation through detection of cAMP production. The approach can be configured for either liquid-phase or vapor-phase odorant stimulation, with the latter more closely mimicking natural olfactory processes .

  • Calcium imaging: Using calcium-sensitive fluorescent dyes or genetically encoded calcium indicators to monitor intracellular calcium changes upon receptor activation.

  • Patch-clamp electrophysiology: For measuring electrical responses following receptor activation.

For vapor-phase stimulation specifically, the protocol involves:

  • Equilibrating the monitoring chamber with vaporized odorant prior to plate reading

  • Allowing odorant molecules to dissolve into the buffer bathing the cells

  • Recording luminescence as cAMP levels rise following receptor activation

  • Normalizing data to appropriate controls and calculating response parameters such as area under the curve (AUC)

This approach offers the advantage of more closely replicating physiological conditions where odorants reach the olfactory epithelium in vapor phase rather than in solution.

How can I design experiments to determine Olfr146 ligand specificity and sensitivity?

To comprehensively characterize Olfr146 ligand specificity and sensitivity, a structured experimental approach should include:

  • Dose-response curve analysis: Test potential ligands at multiple concentrations (typically covering at least 6 log units) to determine EC50 values and dynamic ranges. For vapor-phase stimulation, use serial dilutions of pure odorants and ensure testing proceeds from lowest to highest concentration to minimize contamination .

  • Structural analog screening: Test structurally related compounds to identify molecular features critical for receptor activation. This approach can reveal structure-activity relationships.

  • Competition assays: Use known ligands in competition with test compounds to identify potential antagonists or modulators.

  • Normalization controls: Include appropriate controls to account for:

    • Background activity (empty vector controls)

    • Basal receptor activity (normalize to t=0 response)

    • Response variation between different experimental batches

When analyzing data, calculate areas under the curve (AUC) for comprehensive response quantification, as shown for other ORs like Olfr1377 responding to acetophenone at different concentrations :

Acetophenone ConcentrationRelative Olfr1377 Response
Pure (100%)++++ (with toxicity effects at later timepoints)
10⁻² (1%)++++
10⁻⁴ (0.01%)++
10⁻⁶ (0.0001%)-
10⁻⁸ (0.000001%)-

Note that for vapor stimulation, the EC50 values obtained (like the 161 μM for Olfr1377 response to acetophenone) reflect not only receptor affinity but also odorant volatility, dissolution kinetics, and solubility, providing a more physiologically relevant measure than liquid stimulation methods .

How does the genomic context of Olfr146 influence its expression and function?

The genomic context of Olfr146, like other olfactory receptors, significantly impacts its expression patterns and functional properties. Key considerations include:

  • Chromosomal location and clustering: ORs are typically organized in clusters throughout the genome. The specific chromosomal location of Olfr146 may influence its regulation through shared enhancer elements with neighboring OR genes.

  • Promoter regulation: OR gene choice is regulated by complex mechanisms involving OR promoter activation. This includes the interaction of transcription factors with OR gene promoters and the involvement of enhancer elements, such as the H element, which can influence the probability of particular OR genes being expressed.

  • Epigenetic regulation: The single OR expression pattern is maintained through epigenetic mechanisms, including histone modifications and DNA methylation that silence other OR genes once one OR is chosen for expression.

Research approaches to study these factors include:

  • Chromatin immunoprecipitation (ChIP) to identify transcription factors binding to the Olfr146 promoter

  • CRISPR-Cas9 genome editing to manipulate the genomic context

  • Single-cell transcriptomics to analyze expression patterns in individual OSNs

While the search results don't specifically address Olfr146's genomic context, understanding these general principles is crucial for comprehensive receptor characterization .

What are the established methods for investigating Olfr146 axon targeting to the olfactory bulb?

Investigating axon targeting of Olfr146-expressing neurons requires specialized techniques to visualize the precise locations of glomeruli in the olfactory bulb. Established methodologies include:

  • Immunohistochemistry: Using antibodies specific to Olfr146 to label axons and their terminals in the olfactory bulb. The technique can reveal the number, position, and morphology of glomeruli receiving Olfr146 axons. For example, studies with mOR256-17 revealed two distinct glomeruli on both the lateral and medial surfaces of the olfactory bulb in wild-type mice .

  • Genetic labeling approaches: These include:

    • Gene targeting to insert reporter genes (GFP, β-galactosidase) into the Olfr146 locus

    • BAC transgenesis to express fluorescent proteins under the Olfr146 promoter

    • IRES-tauGFP knock-in strategies to visualize axon projections

  • Whole-mount visualization: Especially effective for analyzing the entire projection pattern across the olfactory bulb surface.

  • Serial sectioning and 3D reconstruction: For detailed analysis of glomerular position and structure.

When analyzing results, researchers should assess:

  • The number of glomeruli receiving Olfr146 axons

  • The consistency of glomerular positions between individual animals

  • Whether all Olfr146-expressing neurons project to the same glomeruli, or if there are heterogeneous targeting patterns

  • Whether glomeruli receive exclusive input from Olfr146 neurons or show mixed innervation

How can I investigate the role of odorant-metabolizing enzymes in modulating Olfr146 responses?

Investigating the impact of odorant-metabolizing enzymes on Olfr146 responses requires experimental approaches that can distinguish direct receptor activation from effects mediated by enzymatic modification of odorants. Based on established methodologies, the following approach is recommended:

  • Co-expression studies: Co-transfect Olfr146 with specific metabolizing enzymes (e.g., carboxyl esterase 1d, Ces1d) in heterologous cells to examine how enzymatic activity modifies receptor responses. Previous research has demonstrated that Ces1d, which converts esters to carboxylic acids and alcohols, can significantly modulate OR responses to ester compounds .

  • Enzymatic inhibitor studies: Use specific inhibitors of metabolizing enzymes to distinguish between direct receptor activation and activation following enzymatic conversion.

  • Comparative analysis: Compare responses to parent compounds and their known metabolites to establish structure-activity relationships.

  • Real-time monitoring: Utilize the GloSensor assay with vapor-phase stimulation to observe the kinetics of response modulation, which can provide insights into the temporal dynamics of enzymatic effects.

The experimental design should include controls such as:

  • Empty vector controls

  • Enzyme-only controls (without receptor)

  • Heat-inactivated enzyme controls to confirm enzymatic activity is required

This approach can reveal how the nasal metabolome contributes to olfactory perception by modifying odorant structure before or during receptor interaction, a mechanism that adds another layer of complexity to odor coding beyond simple receptor-ligand interactions .

How can I compare Olfr146 activation patterns with other olfactory receptors to understand odor coding?

To effectively compare Olfr146 activation patterns with other olfactory receptors for understanding odor coding, researchers should employ a systematic approach that integrates multiple analytical methods:

  • Comprehensive receptor screening:

    • Test a diverse panel of odorants across multiple receptors including Olfr146

    • Include structurally related receptors to identify subfamily-specific response properties

    • Create activation matrices showing responses of multiple receptors to multiple odorants

  • Comparative analysis techniques:

    • Hierarchical clustering to group receptors with similar response profiles

    • Principal component analysis (PCA) to reduce dimensionality and identify key determinants of response variation

    • Similarity indices (e.g., Tanimoto coefficients) to quantify receptor-receptor response overlaps

  • Visualization approaches:

    • Heat maps representing activation intensities across receptor-odorant combinations

    • Network graphs showing relationships between receptors based on shared ligands

    • Three-dimensional representations of "odor space" based on receptor activation patterns

  • Combinatorial coding analysis:

    • Examine how Olfr146 contributes to unique activation patterns for specific odors

    • Assess whether Olfr146 shows narrow or broad tuning compared to other receptors

    • Evaluate potential synergistic or antagonistic effects when multiple receptors are activated simultaneously

This comparative approach can reveal important insights about the position of Olfr146 within the larger framework of olfactory coding. For example, research on other receptors has shown that some ORs (like mOR256-17) may be upregulated in certain genetic backgrounds, while others (like mOR28) are downregulated, suggesting differential regulatory mechanisms that could also apply to Olfr146 .

The ultimate goal is to understand how Olfr146 contributes to the combinatorial code that enables discrimination between thousands of odors with a limited number of receptors .

What approaches can effectively correlate Olfr146 activation with behavioral responses in mice?

Correlating Olfr146 activation with behavioral responses requires integrating molecular data with behavioral assays. The following comprehensive approach is recommended:

  • Genetic manipulation strategies:

    • Generate Olfr146 knockout mice to assess behavioral deficits

    • Create mice with Olfr146-expressing neurons that can be optogenetically or chemogenetically activated

    • Develop reporter lines where Olfr146-expressing neurons are labeled for activity tracking (e.g., with GCaMP)

  • Behavioral assays:

    • Odor discrimination tasks: Assess whether mice can distinguish between Olfr146 ligands and structurally similar non-ligands

    • Habituation-dishabituation tests: Measure investigation time to determine whether mice perceive Olfr146 ligands as distinct

    • Conditioned learning paradigms: Train mice to associate Olfr146 activation with rewards or aversive stimuli

    • Innate preference/avoidance tests: Evaluate untrained responses to Olfr146 ligands

  • Correlation analysis:

    • Compare behavioral thresholds with in vitro activation thresholds

    • Analyze dose-dependency relationships between receptor activation and behavioral response intensity

    • Investigate whether partial or full Olfr146 activation leads to quantitatively different behaviors

  • Activity mapping:

    • Use immediate early gene expression (c-Fos, Arc) to map neural activity patterns following exposure to Olfr146 ligands

    • Employ in vivo calcium imaging to correlate Olfr146 neuron activity with behavioral outputs

    • Analyze glomerular activity patterns in the olfactory bulb during odor perception

Studies of mice with genetic modifications affecting olfactory system development (e.g., β3GnT2−/− mice) have shown that despite significant alterations in OR expression and axon targeting, mice often retain remarkable odor discrimination abilities. This suggests complex compensatory mechanisms in the olfactory system that should be considered when interpreting behavioral data related to specific receptors like Olfr146 .

What are the most common challenges in heterologous expression of Olfr146, and how can they be overcome?

Heterologous expression of olfactory receptors, including Olfr146, presents several significant challenges due to their complex biophysical properties. Here are the primary difficulties and recommended solutions:

  • Poor surface expression:

    • Challenge: ORs often accumulate in the endoplasmic reticulum due to inefficient trafficking to the cell membrane.

    • Solutions:

      • Use N-terminal tags such as the rhodopsin-derived Rho-tag or variations thereof

      • Co-express receptor-transporting proteins (RTPs), particularly RTP1S

      • Utilize specialized cell lines like Hana3A that stably express Golf, REEP1, RTP1, and RTP2

      • Consider codon optimization of the Olfr146 sequence for the expression system

  • Variable expression levels:

    • Challenge: Inconsistent expression between experiments affects reproducibility.

    • Solutions:

      • Implement rigorous quality control using flow cytometry to evaluate cell surface expression

      • Consider creating stable cell lines expressing Olfr146

      • Standardize transfection protocols and cell culture conditions

      • Use internal controls to normalize for expression level differences

  • Basal activity variations:

    • Challenge: ORs can show variable levels of basal activity in heterologous systems.

    • Solutions:

      • Always normalize receptor responses to their basal activity (t=0 values)

      • Include appropriate negative controls in every experiment

      • Consider using constitutively active mutants as positive controls

  • Functional validation:

    • Challenge: Confirming that the expressed receptor maintains its native ligand specificity.

    • Solutions:

      • Compare responses in heterologous systems with native neurons when possible

      • Test multiple known ligands to establish response profiles

      • Use structure-activity relationship studies to confirm expected specificity patterns

Implementation of these solutions has significantly improved OR expression in heterologous systems, addressing what was once considered one of the major bottlenecks in olfactory research .

How can I troubleshoot inconsistent results in Olfr146 functional assays?

Troubleshooting inconsistent results in Olfr146 functional assays requires systematic evaluation of multiple experimental variables. This diagnostic approach should include:

  • Cell health and transfection efficiency assessment:

    • Monitor cell viability before and after transfection (aim for >90% viability)

    • Quantify transfection efficiency using reporter genes (e.g., GFP) in parallel wells

    • Verify receptor expression using flow cytometry or immunostaining

    • Ensure consistent cell density and passage number across experiments

  • Reagent quality control:

    • Test odorant purity using analytical methods (e.g., gas chromatography-mass spectrometry)

    • Prepare fresh odorant dilutions for each experiment

    • For vapor stimulation, ensure proper equilibration of the chamber atmosphere

    • Validate assay reagents with positive controls (known receptor-ligand pairs)

  • Assay parameter optimization:

    • For GloSensor assays: Optimize substrate concentration and equilibration time

    • For calcium imaging: Calibrate dye loading and imaging parameters

    • Standardize data collection timepoints and intervals

    • Ensure consistent temperature during assays (small temperature variations can affect receptor function and odorant volatility)

  • Data analysis refinement:

    • Implement robust normalization procedures to account for:

      • Baseline drift

      • Day-to-day variations

      • Differential receptor expression levels

    • Use area under the curve (AUC) calculations rather than peak height for more comprehensive response quantification

    • Apply appropriate statistical tests with attention to sample size requirements

  • Systematic record-keeping:

    • Document all experimental conditions in detail

    • Track potential sources of variation (cell batch, reagent lot numbers, room temperature, etc.)

    • Maintain a troubleshooting log to identify patterns in inconsistencies

Critical control experiments should include:

  • Empty vector controls

  • Known receptor-ligand pairs as positive controls

  • Vehicle-only stimulations

  • Mock transfections to identify non-specific effects

What advanced strategies can improve the physiological relevance of Olfr146 studies?

To enhance the physiological relevance of Olfr146 studies, researchers should implement strategies that better replicate the natural olfactory environment and cellular context. The following advanced approaches are recommended:

  • Vapor-phase odorant stimulation:

    • Implement protocols for delivering odorants in vapor phase rather than liquid phase

    • Establish equilibration of the monitoring chamber with vaporized odorant prior to measurements

    • Consider airflow rate and humidity control to mimic nasal breathing conditions

    • Account for odorant volatility differences when designing experiments and interpreting results

  • Co-expression of olfactory mucosal components:

    • Include odorant-metabolizing enzymes such as carboxyl esterase 1d (Ces1d) to replicate enzymatic modification of odorants in the nasal mucosa

    • Co-express odorant-binding proteins that may modulate ligand access to receptors

    • Consider incorporating mucosal pH and ionic conditions that affect receptor function

  • Advanced cellular models:

    • Use primary cultures of olfactory sensory neurons when possible

    • Develop organoid models of olfactory epithelium expressing Olfr146

    • Consider air-liquid interface cultures to better mimic the olfactory epithelium architecture

    • Implement co-culture systems with supporting cells that may regulate OSN function

  • Integration with computational approaches:

    • Develop or utilize molecular dynamics simulations of Olfr146-odorant interactions

    • Implement machine learning approaches to predict Olfr146 ligands from large compound libraries

    • Create computational models of the olfactory mucosa microenvironment

  • Multi-receptor analysis systems:

    • Develop platforms to simultaneously monitor multiple ORs including Olfr146

    • Create artificial sensor arrays based on OR activation patterns

    • Implement systems to study receptor interactions and combinatorial coding

These advanced strategies collectively address a fundamental limitation in traditional OR research: the gap between highly controlled but artificial in vitro systems and the complex physiological environment of the olfactory epithelium. By incorporating these approaches, researchers can obtain more translatable insights into how Olfr146 functions in vivo and contributes to olfactory perception .

How can single-cell transcriptomics advance our understanding of Olfr146 expression and regulation?

Single-cell transcriptomics offers unprecedented opportunities to elucidate the expression patterns and regulatory mechanisms governing Olfr146 in the complex cellular landscape of the olfactory epithelium. This approach provides several key advantages:

  • High-resolution expression profiling:

    • Identification of the exact proportion of OSNs expressing Olfr146 within the entire OSN population

    • Characterization of the maturation stages at which Olfr146 expression begins and stabilizes

    • Detection of potential co-expression with other genes that may influence Olfr146 function

    • Mapping of Olfr146-expressing cells within distinct zones of the olfactory epithelium

  • Regulatory network identification:

    • Discovery of transcription factors specifically associated with Olfr146 expression

    • Characterization of the epigenetic landscape in Olfr146-expressing neurons

    • Identification of regulatory elements that control the "one neuron-one receptor" rule for Olfr146

    • Analysis of feedback mechanisms that stabilize Olfr146 expression once initiated

  • Comparative analysis across conditions:

    • Evaluation of how developmental stages affect Olfr146 expression

    • Assessment of environmental factors (odorant exposure, inflammation) that may modulate expression

    • Comparison between wild-type mice and genetic models with altered olfactory function

    • Analysis of age-related changes in Olfr146 expression patterns

  • Methodological approaches:

    • Fluorescence-activated cell sorting (FACS) of dissociated olfactory epithelium followed by single-cell RNA sequencing

    • Spatial transcriptomics to correlate Olfr146 expression with anatomical location

    • CRISPR screens to identify genes affecting Olfr146 expression

    • Integration with chromatin accessibility assays (ATAC-seq) at single-cell resolution

While the search results don't specifically address single-cell analysis of Olfr146, studies of other ORs have demonstrated that genetic modifications can significantly alter expression patterns. For example, in β3GnT2−/− mice, some receptors show increased expression (mOR256-17 by nearly 60%) while others show decreased expression (mOR28 by more than 75%) . Similar analyses could reveal important insights about Olfr146 regulation.

What is the potential of using Olfr146 in biosensor applications?

The utilization of Olfr146 in biosensor applications represents an exciting translational direction for olfactory receptor research, with potential applications spanning environmental monitoring, food safety, and medical diagnostics. Based on current technologies and approaches, Olfr146-based biosensors could be developed through the following strategies:

  • Cell-based biosensor platforms:

    • Engineer stable cell lines expressing Olfr146 coupled with reporter systems (luminescence, fluorescence)

    • Develop microfluidic devices for real-time detection of Olfr146 ligands in air or liquid samples

    • Create high-throughput screening systems for environmental contaminants or biomarkers

    • Optimize miniaturized formats for field deployment

  • Cell-free receptor systems:

    • Isolate and stabilize Olfr146 in nanodiscs or other membrane mimetics

    • Couple receptor conformational changes directly to electrical or optical detection systems

    • Develop OR arrays with multiple receptors including Olfr146 for "electronic nose" applications

    • Explore receptor stabilization techniques to extend functional lifetime

  • Technical considerations for implementation:

    • Signal amplification strategies to enhance sensitivity (particularly important for trace detection)

    • Receptor stabilization methods to maintain functionality in non-physiological environments

    • Calibration approaches to account for environmental variables (temperature, humidity)

    • Integration with data processing algorithms for pattern recognition

  • Potential applications for Olfr146-based biosensors:

    • Detection of specific environmental chemicals or pollutants recognized by Olfr146

    • Identification of spoilage compounds or contaminants in food products

    • Screening for biomarkers in breath or body fluids associated with disease states

    • Basic research tools for studying ligand-receptor interactions

Research on OR-based biosensors has shown promise, as highlighted in the GloSensor vapor-phase detection system: "Having shown that our system can detect odorant molecules presented in a vapor phase, this method is a first step in the development process of a miniaturized biosensor" . The specificity and sensitivity of mammalian ORs like Olfr146 make them attractive components for next-generation chemical sensors that can operate with high selectivity at ambient temperatures.

How might comparative genomics of Olfr146 across species inform evolutionary understanding of olfactory systems?

Comparative genomic analysis of Olfr146 across species offers valuable insights into the evolution of olfactory systems and the adaptation of olfactory receptors to different ecological niches. This evolutionary perspective can be explored through several research approaches:

  • Phylogenetic analysis:

    • Identify orthologs of Olfr146 across mammalian species

    • Construct evolutionary trees to trace the receptor's evolutionary history

    • Calculate selective pressure (dN/dS ratios) to identify regions under positive selection

    • Determine the age of Olfr146 relative to other olfactory receptor subfamilies

  • Structural comparative analysis:

    • Compare sequence conservation in ligand-binding domains versus other receptor regions

    • Identify species-specific variations in key functional motifs

    • Model potential structural differences that might affect ligand specificity

    • Correlate receptor sequence variations with known differences in olfactory capabilities

  • Expression pattern comparison:

    • Analyze whether Olfr146 orthologs show conserved or divergent expression patterns across species

    • Compare zonal distribution in the olfactory epithelium between different mammals

    • Assess whether glomerular targeting follows similar rules across species

    • Evaluate developmental timing of expression in different species

  • Functional conservation and divergence:

    • Test whether Olfr146 orthologs from different species respond to the same ligands

    • Determine if sensitivity and specificity have evolved in relation to ecological requirements

    • Identify species-specific ligands that might reflect adaptation to different environments

    • Create chimeric receptors to isolate regions responsible for functional differences

While the search results don't specifically address evolutionary aspects of Olfr146, studies of other olfactory receptors have revealed important evolutionary principles. These include the expansion of OR gene families through duplication events, followed by diversification through mutation and selection, leading to specialized recognition capabilities . Similar patterns likely shaped Olfr146's evolution, possibly reflecting adaptation to detect specific environmentally or behaviorally relevant odorants important to mouse survival.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.