Recombinant Mouse Olfactory receptor 148 (Olfr148)

Shipped with Ice Packs
In Stock

Description

Detection and Quantification

The Abbexa Mouse OLFR148 ELISA Kit enables quantitative measurement in tissue homogenates and biological fluids, with:

  • Detection Range: 0.156–10 ng/mL

  • Sensitivity: Colorimetric assay with a dynamic mid-range optimized for native protein detection .

  • Applications: Tissue localization studies and expression profiling in non-sensory organs .

Spatial Expression in Olfactory Mucosa

Olfr148 is distributed in overlapping zones of the mouse olfactory mucosa, correlating with odorant solubility gradients. This supports the chromatographic theory of olfaction, where receptor positioning optimizes detection of volatile compounds .

Interaction Network

STRING-db predicts functional associations with:

  • G(olf) alpha subunit: Mediates cAMP signaling in olfactory neuroepithelium .

  • Basal ganglia proteins: Suggests potential extranasal roles in neuromodulation .

Research Limitations

  • Ligand Specificity: No direct ligands identified for Olfr148, unlike related receptors (e.g., Olfr558 activated by carboxylic acids ).

  • Extranasal Roles: Detected in renal and visual systems via ELISA , but functional studies are lacking compared to orthologs like OR51E1 .

Comparative Analysis of Olfr148 and Related Receptors

FeatureOlfr148Olfr558 (Related Receptor)
LigandsUnknownButyric acid, isovaleric acid
Expression SitesOlfactory mucosa, basal ganglia Renal cortex, carotid body
OrthologNone confirmedHuman OR51E1

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that we have in stock. However, if you have any specific requirements for the format, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Olfr148; Mor224-4; Olfr7; Olfactory receptor 148; Odorant receptor M30; Olfactory receptor 224-4; Olfactory receptor 7F
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Olfr148
Target Protein Sequence
MDNYTLLNEFILLGIPQTQGLETLLFVVFLFIYFFTLLGNSLIFTAIISSSTLHTPMYFF LGLLSVFDMLFPSVTCPKMLFYLSVRSPAISYKGCAAQLFFYHLLGSTEGCLYSVMAYDR YVAICHPLRYMLIMKPGVCVSLVIIAWLVGCLHATILTSLTFQLVYCASNQVDYFFCDLP AVLPLACTDSKLARKVGSINVGFLALMLLFSVCVSYVHIGVAILRIRSAEGRQKAFSTCS AHLTAILCAYGPVIIIYLQRTPNPLLGAVVQILNNIVSPMLNSLIYSLRNKEVKRSLRRV FQNITFHGQK
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Olfr148 and how is it classified within the mouse olfactory receptor family?

Olfr148 belongs to the large family of odorant receptors in mice, which comprises over 1,100 protein-coding genes distributed across almost all chromosomes. As a G protein-coupled receptor (GPCR), Olfr148 contributes to the mouse's ability to detect specific odorants. It follows the canonical "one neuron-one receptor" rule, where each olfactory sensory neuron expresses only one OR gene from the complete repertoire through tightly regulated mechanisms . Like other ORs, Olfr148 likely shows unequal expression levels in the olfactory epithelium compared to other OR genes, reflecting the complexity of OR gene regulation patterns.

What experimental systems are available for studying recombinant Olfr148?

Several experimental systems can be employed to study recombinant Olfr148:

  • Reporter gene systems: Similar to the P2-IRES-tauGFP knock-in approach used for Olfr17, researchers can generate Olfr148-GFP mice where GFP expression acts as a surrogate marker for Olfr148 expression .

  • Expression platforms: Ex vivo systems can be developed following approaches similar to those described for other ORs, where isolated olfactory cilia can be used for bench-top bioassays to evaluate receptor responses to potential ligands .

  • Flow cytometry: Using fluorescent reporters, Olfr148-expressing cells can be isolated via FACS for downstream analysis, similar to the approach used for Olfr78-GFP mice .

  • Organoid cultures: For studying potential extranasal expression, intestinal organoid systems may be employed to investigate receptor function in non-olfactory tissues .

What are the key methodological considerations when designing primers for Olfr148 RT-qPCR analysis?

When designing primers for Olfr148 RT-qPCR analysis, researchers should consider:

  • Specificity: Due to sequence similarities among OR genes, primers must be designed to amplify specifically Olfr148 and not closely related ORs. The following approach is recommended:

    • Target unique regions of Olfr148 mRNA

    • Design primers with minimal homology to other OR transcripts

    • Validate specificity using BLAST analysis

  • Amplicon size: For optimal qPCR efficiency, design primers that generate amplicons of 70-150 bp similar to those used for other ORs (e.g., Olfr17 and Olfr6) .

  • Reference genes: Include appropriate housekeeping genes for normalization, such as β-actin, as used in studies of other ORs .

  • Controls: Include wild-type and knockout samples when available to validate primer performance.

How do genetic background differences affect Olfr148 expression levels?

Genetic background can significantly impact Olfr148 expression, similar to observations with other ORs like Olfr17. Research suggests the following considerations:

  • Strain-specific expression: Different mouse strains likely express Olfr148 at varying levels due to genetic variations in regulatory regions, as observed with Olfr17 between 129 and B6 strains .

  • cis-regulatory elements: SNPs in promoter and enhancer regions can alter transcription factor binding affinities, potentially creating or eliminating CpG dinucleotides that affect DNA methylation patterns .

  • Methodology for evaluation:

    • RT-qPCR to quantify transcript levels across strains

    • In situ hybridization to determine the number of Olfr148-expressing neurons

    • RNA-seq to compare expression across the complete OR repertoire in different strains

What role does DNA methylation play in Olfr148 regulation?

DNA methylation likely plays a critical role in regulating Olfr148 expression, as observed with other ORs:

  • CpG sites: Genetic variations that create or eliminate CpG dinucleotides in the Olfr148 promoter region may affect methylation patterns. In the case of Olfr17, SNPs in the 129 mouse strain created additional CpG sites compared to the B6 strain, correlating with differential methylation frequencies .

  • Methylation analysis methods:

    • Bisulfite sequencing of the Olfr148 promoter region to quantify methylation frequencies

    • Comparison of methylation patterns between Olfr148-expressing and non-expressing neurons

    • Correlation analysis between methylation status and expression levels

  • Functional consequences: Methylation may influence transcription factor binding to regulatory elements, potentially affecting both the probability of expression and expression levels of Olfr148 .

What is known about the chromatin organization affecting Olfr148 expression?

Olfactory neurons exhibit characteristic nuclear organization that impacts OR gene expression:

  • 3D chromatin architecture: Both cis and inter-chromosomal interactions are required for proper expression of OR genes. Olfr148 expression is likely influenced by its spatial positioning within the nucleus and interactions with other genomic regions .

  • Analysis approaches:

    • Chromosome conformation capture techniques (Hi-C, 4C-seq) to identify genomic interactions involving the Olfr148 locus

    • ATAC-seq to assess chromatin accessibility at the Olfr148 locus in expressing versus non-expressing cells

    • ChIP-seq to identify histone modifications and transcription factor binding at the Olfr148 locus

  • Strain differences: Different mouse strains may exhibit distinct 3D chromatin organization in olfactory nuclei, potentially leading to differential cis and trans effects on Olfr148 expression .

What experimental approaches can identify the ligands that activate Olfr148?

Identifying ligands for Olfr148 presents significant challenges, requiring multiple complementary approaches:

  • Ex vivo cilia preparation: Following methods described for other ORs, cilia from neurons expressing recombinant Olfr148 can be isolated and exposed to potential odorants in both liquid and vapor phase bioassays .

  • Calcium imaging: Neurons or heterologous cells expressing Olfr148 can be loaded with calcium-sensitive dyes to monitor responses to candidate ligands, providing real-time activation data.

  • cAMP assays: As GPCRs typically signal through cAMP, assays measuring changes in cAMP levels can be employed to identify Olfr148 activators.

  • In vivo validation: Potential ligands identified in vitro should be validated in vivo, though this is rarely done due to technical challenges .

How can Olfr148 function be studied in non-olfactory tissues?

Recent research has revealed ectopic expression of olfactory receptors in non-olfactory tissues. To study potential extranasal functions of Olfr148:

  • Expression screening: RT-qPCR and RNA-seq analysis of various tissues to identify those expressing Olfr148.

  • Single-cell transcriptomics: To identify specific cell types expressing Olfr148 in non-olfactory tissues, similar to the identification of Olfr78 in enteroendocrine cells .

  • Conditional knockout models: Generation of tissue-specific Olfr148 knockout mice using Cre-loxP technology, as demonstrated with Vil1Cre/+-Olfr78fx/fx mice to study epithelial-specific knockout effects .

  • Organoid cultures: Development of organoids from tissues expressing Olfr148 to study its function in controlled conditions .

What signaling pathways are activated by Olfr148 stimulation?

To characterize the signaling cascades activated by Olfr148:

  • G-protein coupling specificity:

    • Determine which G-protein subtype (Gαolf, Gαs, etc.) couples with Olfr148

    • Use G-protein inhibitors to confirm specificity

    • Employ BRET or FRET assays to directly measure receptor-G-protein interactions

  • Downstream effectors:

    • Measure adenylyl cyclase activation and cAMP production

    • Assess calcium mobilization using fluorescent indicators

    • Evaluate MAPK pathway activation through phosphorylation of ERK1/2

  • Transcriptional responses:

    • RNA-seq analysis of cells following Olfr148 activation to identify regulated genes

    • ChIP-seq to map transcription factor binding events downstream of receptor activation

How can CRISPR-Cas9 technology be optimized for genetic manipulation of Olfr148?

CRISPR-Cas9 offers powerful tools for manipulating Olfr148:

  • Guide RNA design:

    • Target unique sequences in Olfr148 to prevent off-target effects on other OR genes

    • Use in silico tools to predict off-target sites

    • Validate specificity experimentally

  • Knock-in strategies:

    • Design homology-directed repair templates for precise modifications

    • Insert reporter genes (GFP, RFP) to track expression

    • Introduce specific mutations to study structure-function relationships

  • Validation approaches:

    • Sequence verification of edited regions

    • Functional validation using calcium imaging or cAMP assays

    • Expression analysis using RT-qPCR or in situ hybridization

How can RNA-seq data be analyzed to understand the transcriptional network associated with Olfr148 expression?

RNA-seq analysis of Olfr148-expressing cells can reveal associated gene networks:

  • Cell isolation strategies:

    • FACS sorting of Olfr148-expressing cells using reporter lines

    • Single-cell RNA-seq to capture heterogeneity within the Olfr148-expressing population

  • Bioinformatic analysis pipeline:

    • Differential expression analysis comparing Olfr148+ vs. Olfr148- cells

    • Gene Ontology and pathway enrichment analysis

    • Identification of co-regulated genes and potential regulatory factors

  • Integration with other data types:

    • Correlate with epigenetic profiles (ATAC-seq, ChIP-seq)

    • Integrate with protein interaction networks

    • Compare with transcriptomes of cells expressing other OR genes

How do mutations in the Olfr148 promoter region affect gene expression patterns?

To investigate the impact of promoter mutations on Olfr148 expression:

  • Mutation identification and analysis:

    • Sequence the Olfr148 promoter across different mouse strains to identify natural variants

    • Use computational tools to predict the impact of variants on transcription factor binding sites and CpG dinucleotides

  • Functional validation:

    • Luciferase reporter assays with wild-type and mutant promoters

    • CRISPR-mediated introduction of specific promoter mutations

    • Analysis of methylation patterns at mutated CpG sites

  • Expression consequences:

    • Quantify changes in the number of Olfr148-expressing neurons

    • Measure Olfr148 transcript levels using RT-qPCR

    • Assess potential impacts on neighboring OR genes in the same cluster

How conserved is Olfr148 across different rodent species?

Understanding the evolutionary conservation of Olfr148 provides insights into its functional importance:

  • Sequence analysis:

    • Identify Olfr148 orthologs across rodent species

    • Calculate sequence conservation at nucleotide and amino acid levels

    • Identify conserved functional domains and variable regions

  • Selective pressure analysis:

    • Calculate dN/dS ratios to assess evolutionary constraints

    • Identify positively selected sites potentially involved in species-specific odor detection

    • Compare with conservation patterns of other OR genes

  • Expression pattern comparison:

    • Use RT-qPCR and in situ hybridization to compare expression levels and patterns across species

    • Correlate expression differences with sequence variations in regulatory regions

What insights can be gained from comparing the ligand specificity of Olfr148 with its human ortholog?

Comparative functional analysis between mouse Olfr148 and its human ortholog can reveal evolutionary adaptations in olfactory perception:

  • Ortholog identification:

    • Use sequence similarity and synteny analysis to identify the human ortholog

    • Compare protein structures, focusing on the ligand-binding domain

  • Functional comparison:

    • Express both receptors in heterologous systems

    • Screen against odorant libraries to identify shared and distinct ligands

    • Quantify response kinetics and sensitivity

  • Structure-function implications:

    • Map species-specific amino acid differences to the predicted 3D structure

    • Use site-directed mutagenesis to convert mouse-specific residues to human-specific ones and vice versa

    • Correlate functional differences with ecological and behavioral adaptations

How can the problem of low Olfr148 surface expression in heterologous systems be overcome?

Surface expression of olfactory receptors in heterologous systems is notoriously challenging:

  • Expression enhancement strategies:

    • Use rho-tag or Lucy-tag signal sequences to improve trafficking

    • Co-express accessory proteins (RTP1S, RTP2, REEP1)

    • Optimize codon usage for the expression system

  • System selection:

    • Compare expression efficiency across different cell lines (HEK293, Hana3A)

    • Consider inducible expression systems to reduce toxicity

    • Explore novel cell-free expression systems for functional studies

  • Verification methods:

    • Use surface immunostaining with epitope-tagged receptors

    • Employ ELISA to quantify surface expression levels

    • Validate functionality using calcium imaging or cAMP assays

What are the most reliable methods for quantifying changes in Olfr148 expression levels?

Accurate quantification of OR expression is essential for understanding regulatory mechanisms:

  • RNA quantification approaches:

    • RT-qPCR with carefully designed primers specific to Olfr148

    • Digital droplet PCR for absolute quantification

    • RNA-seq with appropriate normalization strategies

  • Protein-level quantification:

    • Western blotting with validated antibodies

    • Mass spectrometry-based proteomics

    • Flow cytometry for cells expressing tagged Olfr148

  • Single-cell approaches:

    • Single-cell RNA-seq to assess expression heterogeneity

    • smFISH (single-molecule fluorescence in situ hybridization) to count individual mRNA molecules

    • Quantitative immunohistochemistry with digital image analysis

How can experimental variability in Olfr148 functional assays be minimized?

Reducing variability in functional assays improves reproducibility and data reliability:

  • Standardization protocols:

    • Establish consistent cell culture conditions and passage numbers

    • Standardize transfection efficiency monitoring

    • Use automated liquid handling systems for reagent addition

  • Internal controls:

    • Include positive control receptors with known ligands

    • Implement dose-response curves rather than single concentrations

    • Use multiple independent biological replicates

  • Data analysis considerations:

    • Establish clear criteria for positive responses

    • Implement blinded analysis when possible

    • Use appropriate statistical tests accounting for multiple comparisons

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.