Recombinant Mouse Olfactory receptor 149 (Olfr149)

Shipped with Ice Packs
In Stock

Description

Production and Engineering

Recombinant Olfr149 is produced via heterologous expression systems, often with modifications to enhance stability and detection:

Host SystemTagApplicationSource
Mammalian CellsHis, Avi&FcPurification and detection
HEK293T CellsFlag, Rho, LucySurface expression and functional assays
E. coliHisHigh-yield production

Key engineering strategies include:

  • Lucy tag: A cleavable N-terminal signal peptide that improves surface expression in HEK293T cells, particularly when co-expressed with chaperones (RTP1S, Ric8b, Gαolf) .

  • Rho tag: Enhances surface localization but is less effective without the Lucy tag .

Functional and Biological Roles

Olfr149 mediates odorant recognition through interactions with hydrophobic pockets in transmembrane domains (TM3, TM5, TM6) . While specific ligands remain unidentified, studies highlight:

  • Expression in olfactory epithelium (OE): RNA-Seq data confirm Olfr149 expression in OE, particularly in fluorescence-activated cell-sorted olfactory receptor neurons (ORNs) .

  • G-protein coupling: Activates cAMP-dependent pathways, though functional assays require co-expression with Gαolf and chaperones .

Research Applications

Recombinant Olfr149 is utilized in diverse experimental settings:

ApplicationMethodOutcomeSource
Functional StudiesLuciferase assays (cAMP signaling)Measures odorant-induced G-protein activation
Surface ExpressionImmunofluorescence (Flag antibody)Quantifies membrane localization efficiency
Quantitative AnalysisELISA kits (0.156–10 ng/ml range)Detects Olfr149 in tissue lysates/cell homogenates

Key Research Findings

  1. Improved Surface Expression: The Lucy tag increases surface expression in HEK293T cells to >90% for most ORs when combined with chaperones .

  2. Ligand Binding Specificity: Mutagenesis studies suggest TM3, TM5, and TM6 domains determine odorant selectivity via hydrophobic interactions .

  3. Olfactory Epithelium Specificity: RNA-Seq confirms Olfr149 expression in ORNs, aligning with its role in olfaction .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery details, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipment is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
Olfr149; Mor224-8; Olfr7; Olfactory receptor 149; Odorant receptor M31; Olfactory receptor 224-8; Olfactory receptor 7G
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-311
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Olfr149
Target Protein Sequence
MKNLSVVTQFILLGIPHTEGVETMLFVLFFSFYIFTLVGNLLILLAIVSSSRLHTPMYFF LCQLSVCDIFFPSVSSPKMLFYLSGNTPAISYAGCVSQLFFYHFLGGTECFLYTVMAYDR FVAICYPLRYSVIMSHRICAFLAMGTAVFGCIHSTFLTTLTFQLPYCGPKDVNYYFCDIP VVMKLACADTSTLEMVGFISVGLMPLSCFFFILTSYSCIVRSILQIRSTEGRHRAFSTCS AHFTAILLFYMPVIFIYLRPTPSPWLDATVQILNNLVTPMLNPLIYSLRNKEVKSSLWTV LHLLCFLPKHL
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Olfactory Receptor 149 (Olfr149) and its function in mouse olfaction?

Olfactory Receptor 149 (Olfr149) is a G protein-coupled receptor expressed in the olfactory epithelium of mice that plays a critical role in the detection of specific odorant molecules. Like other olfactory receptors, Olfr149 follows the "one neuron-one receptor" rule, where each olfactory sensory neuron typically expresses only one olfactory receptor gene. The receptor's activation triggers a signaling cascade that ultimately results in odorant perception. Research suggests that Olfr149 responds to a specific subset of odorant molecules, contributing to the mouse's ability to discriminate between different scents. Understanding Olfr149's activation patterns provides insights into the molecular basis of olfactory coding and odor discrimination in mammals.

How does genetic background affect Olfr149 expression in different mouse strains?

Genetic background significantly influences olfactory receptor expression, including Olfr149. Similar to what has been observed with other olfactory receptors like Olfr17, different mouse strains can exhibit variable expression levels due to genetic variations in cis-regulatory regions . For instance, research on Olfr17 has demonstrated that the 129-mouse strain shows higher expression levels compared to the B6 strain, with quantifiable differences in both the number of expressing neurons and transcript levels . These strain-specific differences may result from variations in promoter regions, enhancer elements, or DNA methylation patterns that collectively regulate gene expression. When studying Olfr149, researchers should account for strain-specific variations by clearly documenting the genetic background of their mouse models and potentially comparing expression across different strains to establish baseline differences.

What experimental models are available for studying Olfr149?

Several experimental models are available for studying Olfr149, each with distinct advantages for particular research questions:

  • In vivo mouse models: Wild-type mice of different genetic backgrounds (C57BL/6, 129, etc.) allow for comparative expression analysis

  • Knockout models: Olfr149-deficient mice enable assessment of functional consequences

  • Knock-in reporter models: Similar to the P2-GFP model used for Olfr17 , where fluorescent proteins are inserted to track expression

  • Heterologous expression systems: Cell lines (HEK293, Hana3A) transfected with Olfr149 for ligand identification

  • Ex vivo tissue preparations: Olfactory epithelium explants for electrophysiological and calcium imaging studies

For recombinant protein studies, bacterial (E. coli) and mammalian expression systems have been developed to produce the receptor for structural and biochemical analyses, though membrane protein expression remains technically challenging.

How can I optimize recombinant expression of Olfr149 for functional studies?

Optimizing recombinant expression of Olfr149 requires addressing several technical challenges inherent to G protein-coupled receptors:

  • Expression system selection: While E. coli systems offer high yield, mammalian cell lines (HEK293T, CHO) better facilitate proper folding and post-translational modifications essential for functionality. Insect cell systems (Sf9, Hi5) represent an intermediate option with improved yield over mammalian cells.

  • Vector design considerations:

    • Include an N-terminal signal sequence to ensure proper membrane trafficking

    • Incorporate a rhodopsin-derived N-terminal tag to enhance surface expression

    • Add a C-terminal tag (His, FLAG) for purification while avoiding interference with G protein coupling

    • Consider codon optimization for the expression system

  • Co-expression factors: Co-express accessory proteins like Receptor Transporting Proteins (RTPs) and Receptor Expression Enhancing Proteins (REEPs) that facilitate receptor trafficking to the cell surface. The Hana3A cell line, with stably integrated RTP1S, RTP2, and REEP1, has demonstrated superior expression for many olfactory receptors compared to standard HEK293T cells.

  • Temperature modulation: Lowering incubation temperature to 30-32°C after transfection can improve folding efficiency and reduce degradation of the recombinant receptor.

Functional validation of expressed Olfr149 should employ multiple complementary techniques, including surface immunostaining, calcium imaging, and cAMP accumulation assays to confirm both expression and signaling competence.

What techniques are most effective for identifying Olfr149 ligands?

Identifying ligands for Olfr149 requires a systematic approach combining multiple screening methodologies:

  • High-throughput functional screening:

    • Calcium imaging assays using fluorescent calcium indicators in Olfr149-expressing cells

    • FLIPR (Fluorescent Imaging Plate Reader) technology for automated detection of receptor activation

    • cAMP accumulation assays using FRET-based sensors

    • Luciferase reporter systems driven by cAMP response elements (CRE)

  • Structure-based virtual screening:

    • Homology modeling based on solved GPCR structures

    • Molecular docking of candidate odorants

    • Molecular dynamics simulations to assess binding stability

  • Confirmatory assays:

    • Dose-response analyses to determine EC₅₀ values

    • Competition binding assays with identified agonists

    • Single-cell electrophysiology to validate responses in native neurons

When establishing a data table for ligand screening results, organize information systematically as follows:

CompoundChemical ClassEC₅₀ (μM)Efficacy (% max)Receptor SpecificitySource/Reference
Compound AAldehyde15.3 ± 2.1100Olfr149-selectiveReference X
Compound BKetone42.7 ± 5.678 ± 7Activates Olfr149 and Olfr151Reference Y

Include experimental conditions as footnotes and clearly specify the assay system used, as results may vary depending on the detection method and expression system employed.

How should I design experiments to study Olfr149 expression patterns across different tissues?

When designing experiments to study Olfr149 expression patterns, implement a comprehensive approach that incorporates multiple complementary techniques:

  • Tissue selection and preparation:

    • Main olfactory epithelium (MOE): Separate into dorsal, medial, and ventral zones

    • Control tissues: Brain regions, non-neural tissues to confirm specificity

    • Consider developmental timepoints (embryonic, neonatal, adult)

    • Process tissues consistently with RNase-free conditions for RNA analysis

  • Quantitative methods:

    • RT-qPCR: Design primers unique to Olfr149 with minimal cross-reactivity to other olfactory receptors

    • RNA-seq: For unbiased transcriptome-wide analysis and comparison across tissues

    • Single-cell RNA-seq: To determine the percentage of olfactory sensory neurons expressing Olfr149

    • In situ hybridization: To visualize spatial distribution patterns

  • Experimental controls:

    • Housekeeping genes: Include at least three stable reference genes (e.g., GAPDH, β-actin, 18S rRNA)

    • Positive controls: Include primers for known olfactory markers (OMP, Golf)

    • Negative controls: Non-template controls and tissues known not to express olfactory receptors

When presenting expression data, follow the formatting principles demonstrated in scientific publications3, with clear labeling of independent variables (tissue type, genetic background, developmental stage) and dependent variables (expression level) as shown below:

Tissue RegionNormalized Olfr149 Expression (ΔCt)Olfr149+ Neurons/mm²
Dorsal MOE1.00 ± 0.087.5 × 10⁻⁵ ± 0.6
Medial MOE0.65 ± 0.074.8 × 10⁻⁵ ± 0.5
Ventral MOE0.12 ± 0.030.9 × 10⁻⁵ ± 0.2

How do I analyze genetic variants of Olfr149 across mouse strains?

Analyzing genetic variants of Olfr149 across mouse strains requires a methodical approach that integrates genomic sequencing with functional characterization:

  • Sequence acquisition and alignment:

    • Extract genomic DNA from different mouse strains (C57BL/6, 129, BALB/c, etc.)

    • Amplify the Olfr149 coding region and promoter (approximately 2kb upstream)

    • Sequence using next-generation sequencing for high coverage

    • Align sequences against reference genomes using tools like MUSCLE or Clustal Omega

  • Variant identification and characterization:

    • Identify single nucleotide polymorphisms (SNPs) and insertions/deletions

    • Determine if variants affect coding regions (synonymous vs. non-synonymous) or regulatory elements

    • Analyze conserved binding motifs in promoter regions that might influence expression

  • Epigenetic characterization:

    • Assess DNA methylation patterns using bisulfite sequencing, as methylation frequency can influence expression levels as seen with other olfactory receptors

    • Examine histone modifications (ChIP-seq) around the Olfr149 locus

  • Functional correlation:

    • Compare expression levels between strains using RT-qPCR

    • Quantify the number of neurons expressing Olfr149 per unit area using in situ hybridization

    • Correlate genetic/epigenetic variations with expression differences

When reporting strain differences, present data similar to that observed with Olfr17, where significant expression differences were documented between mouse strains . A comprehensive table should include:

Mouse StrainPromoter VariantsCoding VariantsMethylation Frequency (%)Neurons Expressing Olfr149/μm²Relative mRNA Level
C57BL/6ReferenceReference72.4 ± 3.55.8 × 10⁻⁵ ± 0.41.00 ± 0.06
129-496 G>A, -325 T>CCoding SNP 158.2 ± 4.27.6 × 10⁻⁵ ± 0.51.31 ± 0.09
BALB/c-882 A>GNone69.7 ± 3.86.2 × 10⁻⁵ ± 0.51.08 ± 0.07

What methods are most sensitive for detecting low-abundance Olfr149 transcripts?

Detecting low-abundance Olfr149 transcripts presents a significant challenge due to the sparse expression pattern of individual olfactory receptors. The following methods offer increasing sensitivity for accurate detection:

  • Digital PCR (dPCR):

    • Provides absolute quantification without reliance on standard curves

    • Partitions the sample into thousands of individual reactions

    • Particularly valuable for detecting rare transcripts with higher precision than qPCR

    • Can reliably detect differences as small as 1.2-fold between samples

  • Single-cell RNA sequencing (scRNA-seq):

    • Allows identification of individual Olfr149-expressing neurons

    • Overcomes dilution effects inherent in whole-tissue analysis

    • Newer protocols like Smart-seq3 offer improved sensitivity for low-abundance transcripts

    • Can be coupled with cell sorting to pre-enrich for olfactory sensory neurons

  • RNAscope in situ hybridization:

    • Offers single-molecule detection sensitivity in tissue sections

    • Maintains spatial information about expressing cells

    • Allows multiplexing to co-localize Olfr149 with cell-type markers

    • Provides quantifiable signal suitable for comparative analysis

  • Targeted RNA capture sequencing:

    • Uses probe sets designed to capture Olfr149 and other olfactory receptor transcripts

    • Enriches target sequences prior to sequencing, increasing depth of coverage

    • Cost-effective compared to whole-transcriptome sequencing when focusing on specific gene families

When comparing transcript detection methods, incorporate technical replicates and assess consistency across detection platforms. Based on approaches used for other olfactory receptors , sensitivity limits should be clearly reported:

Detection MethodLower Limit of Detection (copies/reaction)Dynamic Range (orders of magnitude)Relative CostSpatial Information
RT-qPCR~106-7$No
Digital PCR~14-5$$No
RNAscope~13-4$$$Yes
scRNA-seq~5-103$$$$Limited

How do epigenetic modifications influence Olfr149 expression regulation?

Epigenetic modifications play a crucial role in regulating olfactory receptor expression, including Olfr149. Understanding these mechanisms requires investigation of several key factors:

  • DNA methylation dynamics:

    • CpG methylation in promoter regions correlates with olfactory receptor silencing

    • As observed with other olfactory receptors like Olfr17, differential methylation frequencies can occur between alleles and across mouse strains

    • DNA methylation patterns should be assessed using bisulfite sequencing with specific attention to:

      • CpG islands in the promoter region (typically 1-2kb upstream)

      • Enhancer elements, particularly the H element equivalent for the Olfr149 cluster

      • Gene body methylation, which may affect transcriptional elongation

  • Histone modifications:

    • Active olfactory receptor genes associate with euchromatic marks (H3K4me3)

    • Silent olfactory receptor genes associate with heterochromatic marks (H3K9me3, H3K27me3)

    • ChIP-seq analysis should target these key modifications across the Olfr149 locus

    • Compare histone modification patterns between expressing and non-expressing tissues

  • Chromatin organization:

    • Nuclear architecture plays a significant role, as olfactory receptor genes cluster in "compartments"

    • 3D chromatin conformation can be assessed using Chromosome Conformation Capture (3C, 4C, Hi-C)

    • Analyze interchromosomal interactions that may regulate the "one receptor-one neuron" rule

  • Transcription factor binding:

    • Identify binding sites for known regulators (Lhx2, Ebf, Olf-1) in the Olfr149 promoter

    • Perform ChIP-seq to confirm occupancy in expressing versus non-expressing cells

Research on other olfactory receptors has shown that these epigenetic factors do not operate in isolation but interact to establish and maintain expression patterns . When analyzing epigenetic data, integrate multiple layers of information as shown in this example table:

Gene RegionDNA Methylation (%)H3K4me3 EnrichmentH3K9me3 EnrichmentChromatin AccessibilityExpression Level
Promoter78.3 ± 4.2LowHighClosedSilenced
Promoter32.4 ± 5.1HighLowOpenExpressed
Gene Body65.2 ± 3.7ModerateLowIntermediateExpressed

What are the best assay systems to evaluate Olfr149 activation by potential ligands?

Evaluating Olfr149 activation requires robust assay systems that can reliably detect receptor responses to potential ligands. The following approaches offer complementary information about receptor functionality:

  • Calcium mobilization assays:

    • Basis: GPCR activation leads to calcium release from intracellular stores

    • Implementation options:

      • Fluorescent calcium indicators (Fluo-4, Fura-2) with plate reader or microscopy detection

      • Genetically encoded calcium indicators (GCaMP variants) for improved sensitivity

      • Automated systems like FLIPR for high-throughput screening

    • Advantages: Rapid response (seconds to minutes), amenable to high-throughput screening

    • Limitations: May require co-expression of promiscuous G proteins (Gα15/16) for coupling

  • cAMP-based assays:

    • Basis: Olfactory receptors couple to Golf, activating adenylyl cyclase and increasing cAMP

    • Implementation options:

      • ELISA-based detection of cAMP accumulation

      • Genetically encoded FRET sensors (EPAC-based) for real-time monitoring

      • CRE-luciferase reporter systems for amplified signal detection

    • Advantages: More direct measure of native signaling pathway, good dynamic range

    • Limitations: Slower response kinetics than calcium assays

  • Bioluminescence resonance energy transfer (BRET):

    • Basis: Measures proximity between receptor and signaling proteins in real-time

    • Implementation options:

      • Receptor-Rluc and β-arrestin-YFP for monitoring receptor activation and desensitization

      • G protein dissociation assays using labeled Gα and Gβγ subunits

    • Advantages: Provides kinetic information, minimal cellular perturbation

    • Limitations: Requires protein engineering, lower throughput

  • Electrophysiological recordings:

    • Basis: Direct measurement of membrane current changes upon receptor activation

    • Implementation options:

      • Patch-clamp recording from native neurons or heterologous cells

      • Field potential recordings from olfactory epithelium preparations

    • Advantages: Highest temporal resolution, most physiologically relevant

    • Limitations: Low throughput, technically demanding

When reporting assay performance for Olfr149 activation studies, provide a detailed comparison table:

Assay SystemSignal-to-Noise RatioZ'-factorEC₅₀ Range DetectionTime ResolutionThroughput (compounds/day)
Calcium imaging8.2 ± 1.40.781 nM - 100 μMSeconds>1000
cAMP-Glo5.4 ± 0.90.6510 nM - 100 μMMinutes>500
BRET3.8 ± 0.70.591 nM - 10 μMSeconds~100
Patch-clamp12.5 ± 2.30.85100 pM - 10 μMMilliseconds5-10

Several cutting-edge technologies are poised to transform research on Olfr149 and other olfactory receptors:

  • Cryo-electron microscopy (cryo-EM):

    • Recent advances in single-particle cryo-EM have enabled structure determination of challenging membrane proteins

    • Application to Olfr149 would reveal binding pocket architecture and conformational changes upon activation

    • Improved detergents and nanodiscs specifically designed for GPCRs enhance stability for structural studies

    • Combining structural data with molecular dynamics simulations can provide unprecedented insights into ligand recognition mechanisms

  • CRISPR-based technologies:

    • CRISPR-Cas9 gene editing allows precise modification of Olfr149 in the native genomic context

    • CRISPRi/CRISPRa systems enable reversible manipulation of Olfr149 expression

    • Prime editing permits introduction of specific point mutations without double-strand breaks

    • Base editing facilitates systematic modification of regulatory elements without selection markers

  • Organoid and microfluidic systems:

    • Olfactory epithelium organoids recapitulate the cellular diversity of native tissue

    • Microfluidic "nose-on-a-chip" platforms allow controlled odorant exposure under physiological conditions

    • Integration with real-time imaging enables dynamic studies of receptor activation and adaptation

    • Co-culture systems can model receptor-dependent axon guidance and glomerular formation

  • Artificial intelligence approaches:

    • Machine learning algorithms can predict Olfr149 ligands based on physicochemical properties

    • Deep learning models integrating structural and functional data improve virtual screening efficiency

    • Natural language processing of the scientific literature can identify overlooked connections between Olfr149 and biological processes

    • AI-guided experimental design optimizes resource allocation for complex multi-variable experiments

These technologies will collectively enable researchers to address fundamental questions about Olfr149 function, from molecular interactions to systems-level integration in olfactory coding.

How can conflicting data about Olfr149 expression or function be reconciled?

Conflicting data about Olfr149 expression or function can arise from numerous sources, including methodological differences, genetic background variations, and environmental factors. The following systematic approach helps reconcile discrepancies:

  • Methodological standardization:

    • Compare detection methods (qPCR, RNA-seq, in situ hybridization) for sensitivity and specificity differences

    • Standardize experimental conditions including tissue collection, processing, and analysis protocols

    • Implement identical primer/probe sets when comparing across studies

    • Use absolute quantification methods (digital PCR) to eliminate calibration differences

  • Genetic background considerations:

    • Document complete strain information, including substrain designations

    • Assess strain-specific polymorphisms in the Olfr149 coding and regulatory regions

    • Consider allele-specific expression patterns as observed with other olfactory receptors

    • Perform backcrossing experiments to isolate genetic contributions to phenotypic differences

  • Environmental and developmental factors:

    • Control for age-dependent expression changes

    • Document housing conditions (diet, light cycles, temperature) that may affect receptor expression

    • Consider olfactory experience/exposure history that could modify expression through feedback mechanisms

    • Evaluate seasonal variations that may influence endocrine factors affecting gene expression

  • Technical validation across platforms:

    • Implement orthogonal methods to confirm key findings

    • Use spike-in controls to establish detection limits

    • Perform systematic replications in independent laboratories

    • Consider observer bias in subjective assessments

When presenting reconciliation of conflicting data, organize information in comparative tables that highlight key methodological differences:

StudyGenetic BackgroundAgeDetection MethodTissue ProcessingOlfr149 Expression LevelLikely Explanation for Discrepancy
Lab AC57BL/6J8 weeksRT-qPCRFresh frozenHighStrain-specific expression
Lab BC57BL/6N12 weeksRNA-seqRNAlaterModerateSuboptimal RNA preservation
Lab CC57BL/6J8 weeksIn situParaformaldehydeLowLess sensitive detection method

By systematically addressing these variables, researchers can transform apparent contradictions into mechanistic insights about the regulation and function of Olfr149.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.