Recombinant Mouse Olfactory receptor 154 (Olfr154)

Shipped with Ice Packs
In Stock

Description

Molecular Function and Signaling Pathways

Olfr154 functions as a chemosensory receptor in two primary systems:

Olfactory System

  • Detects odorants via Gα<sub>olf</sub>-mediated cAMP signaling in olfactory sensory neurons (OSNs) .

  • Located in OSN cilia, it contributes to odorant reception and axon targeting to specific olfactory bulb glomeruli .

Gastrointestinal System

  • Expressed in enteroendocrine cells (EC and L subtypes) of the proximal and distal colon .

  • Responds to short-chain fatty acids (SCFAs) like acetate, promoting enterochromaffin cell differentiation .

SystemLigandsFunctional Role
OlfactoryDicarboxylic acids, aldehydesOdor detection and neural encoding
GastrointestinalAcetate, propionateEC cell differentiation, gut homeostasis

Research Applications

Recombinant Olfr154 is utilized in:

Gene Manipulation

  • Overexpression: AAV vectors (e.g., AAV-266870) with CMV or cell-specific promoters .

  • Silencing: shRNA constructs (e.g., shAAV-266870) targeting Olfr154 mRNA .

Ligand Screening

  • In silico docking studies identified 19 agonists and 3 antagonists, including structurally diverse compounds (e.g., aldehydes, esters) .

  • Functional validation via Xenopus oocyte electrophysiology confirmed ligand-receptor interactions .

Gut Physiology Studies

  • Olfr78 (human ortholog of Olfr154) knockout mice exhibit impaired EC differentiation and altered microbiota .

Ligand Specificity

  • Olfr154 preferentially binds medium-chain dicarboxylic acids (C8–C10), with nonanedioic acid as a high-affinity agonist .

  • Antagonists include phenyl-containing compounds (e.g., benzaldehyde derivatives) .

Epigenetic Regulation

  • Olfr154 mRNA has high AU-content and AU-rich elements (AREs), enabling post-transcriptional regulation in OSNs .

  • Cooperative binding of transcription factors Ebf and Lhx2 to enhancers regulates monogenic expression .

Spatial Expression

  • In the olfactory mucosa, Olfr154 is zonally restricted, correlating with odorant solubility gradients .

Future Directions

  • Ligand-Receptor Dynamics: Structural studies to resolve Olfr154 activation mechanisms.

  • Therapeutic Targets: Exploring Olfr154’s role in gut dysbiosis and metabolic disorders .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
Olfr154; Mor175-1; Olfr4-3; Or912-93; Or93; Olfactory receptor 154; Olfactory receptor 175-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-318
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Olfr154
Target Protein Sequence
MMHRNQTVVTEFFFTGLTSSFHLQIVLFLTFLCVYLATLLGNLGMIILIHLDTRLHIPMY FFLSHLSFVDACSSSVISPKMLSDMFVDKKVISFLGCAIQLCLFSQFVVTECFLLASMAY DRYVAICKPLLYTLIMSQRVCVQLVIGPYSIGFVSTMVHIISAFVLPYCGPNLINHFFCD LLPVLSLACANTQMKKRLLFIVAGILGVFSGIIILVSYVYIAITILKISSADGRRKAFST CSSHLTAVSILYGTLFFIYVRPSSSFSLDINKVVSLFYTTVIPMLNPFIYSLRNKEVKDA LIRTFEKQFCYSFQDKIL
Uniprot No.

Target Background

Function
Potential odorant receptor.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the role of Olfr154 in the mouse olfactory system?

Olfr154 functions as one of the numerous olfactory receptors (ORs) in the mouse olfactory system that collectively enable odor detection and discrimination. Like other ORs, Olfr154 is expressed in olfactory sensory neurons (OSNs) in the olfactory epithelium and plays a crucial role in the initial steps of olfactory signal transduction. These receptors typically bind specific odorant molecules, initiating a signaling cascade that ultimately leads to odor perception.

In the mouse olfactory system, individual odorants are recognized by multiple ORs, creating complex patterns of receptor activation. Olfactory receptors like Olfr154 contribute to these combinatorial codes that allow mice to discriminate between thousands of different odors . The specific contribution of Olfr154 to this process depends on its odorant binding profile and expression patterns in the olfactory epithelium.

To investigate Olfr154's specific role, researchers typically employ similar approaches to those used for other ORs, including receptor expression analysis in different regions of the olfactory epithelium, functional characterization through calcium imaging or electrophysiological recordings, and behavioral studies using knockout models.

How are Olfr154 knockout mice generated for research purposes?

Generation of Olfr154 knockout mice follows standard genetic engineering protocols used for other olfactory receptor knockouts. The process typically involves the following methodological steps:

  • Design of targeting vectors that disrupt the Olfr154 coding sequence, often by replacing critical portions with a reporter gene (such as GFP) and/or a selection marker.

  • Introduction of the targeting construct into mouse embryonic stem (ES) cells through electroporation or other transfection methods.

  • Selection of successfully targeted ES cells using positive and negative selection markers.

  • Verification of proper targeting through PCR, Southern blotting, and sequencing to confirm the disruption of the Olfr154 gene.

  • Injection of validated ES cells into mouse blastocysts to generate chimeric mice.

  • Breeding of chimeric mice to produce heterozygous Olfr154 knockout mice, followed by interbreeding to obtain homozygous knockouts.

The validation of successful knockout requires confirmation at the DNA level (genotyping), RNA level (RT-PCR to confirm absence of Olfr154 transcript), and protein level (immunohistochemistry if antibodies are available) . This approach is similar to that used for generating knockouts of other olfactory receptors such as MOR215-1 and Olfr288 described in the literature.

What are the recommended protocols for detecting Olfr154 expression in tissue samples?

Detection of Olfr154 expression in tissue samples requires sensitive methods due to the typically low expression levels of individual olfactory receptors. Recommended protocols include:

In situ hybridization (ISH):

  • Prepare tissue sections (10-16 μm) from fresh-frozen or fixed mouse olfactory epithelium.

  • Generate RNA probes (sense and antisense) specific to Olfr154 mRNA sequences.

  • Perform hybridization under stringent conditions (typically 55-65°C) to ensure specificity.

  • Visualize using colorimetric (e.g., NBT/BCIP) or fluorescent detection methods.

  • Include appropriate controls, such as known olfactory epithelium markers and sense probes.

Immunohistochemistry (IHC):

  • Fix tissue samples appropriately (typically 4% paraformaldehyde).

  • Prepare sections (10-20 μm) and perform antigen retrieval if necessary.

  • Block non-specific binding sites with appropriate serum.

  • Incubate with validated anti-Olfr154 primary antibodies (note that specific antibodies may be difficult to obtain due to high sequence similarity between ORs).

  • Apply fluorescently-labeled secondary antibodies and counterstain nuclei with DAPI.

  • Analyze using confocal microscopy to precisely localize Olfr154 expression.

RT-PCR and qPCR:

  • Extract total RNA from microdissected olfactory epithelium regions.

  • Synthesize cDNA using reverse transcriptase.

  • Design and validate Olfr154-specific primers that do not amplify closely related OR genes.

  • Perform PCR or qPCR with appropriate controls (positive, negative, and housekeeping genes).

  • Confirm specificity by sequencing PCR products.

These methodological approaches should be combined when possible to provide convergent evidence of Olfr154 expression patterns .

How can researchers determine specific odorants that activate Olfr154?

Determining the specific odorants that activate Olfr154 requires a systematic approach combining multiple methodologies:

Heterologous Expression Systems:

  • Express Olfr154 in cell lines such as HEK293T cells along with the necessary signaling components (e.g., Gαolf, RTP1S, RTP2).

  • Perform calcium imaging or cAMP assays to detect receptor activation upon odorant exposure.

  • Screen a diverse odorant library starting with compounds that activate similar ORs.

  • Perform dose-response analyses to determine EC50 values for identified ligands.

  • Confirm specificity by testing structurally related compounds and using cells expressing other ORs as controls.

Ex Vivo Preparations:

  • Prepare acute slices of olfactory epithelium from mice expressing calcium or voltage indicators in OSNs.

  • Apply candidate odorants while imaging to identify responsive neurons.

  • Use transgenic mice with labeled Olfr154-expressing neurons to directly correlate responses with receptor identity.

In Vivo Approaches:

  • Use functional calcium imaging of the olfactory bulb in anesthetized or awake mice.

  • Present potential Olfr154 ligands and identify activated glomeruli.

  • Confirm the identity of Olfr154-associated glomeruli using genetic labeling or immunohistochemistry.

  • Compare responses between wild-type and Olfr154 knockout mice to validate findings.

Structure-Activity Relationship Analysis:

  • Systematically test structural analogs of identified agonists to map the molecular features required for Olfr154 activation.

  • Develop a pharmacophore model of Olfr154 ligand binding.

  • Use molecular docking simulations to predict binding modes.

This multi-faceted approach has been successfully employed to identify ligands for other olfactory receptors, such as the identification of Z5-14:OH as a ligand for Olfr288 .

What experimental design is most appropriate for studying Olfr154 function in odor-induced behaviors?

The appropriate experimental design for studying Olfr154 function in odor-induced behaviors should incorporate the following methodological considerations:

Subject Selection and Grouping:

  • Use both wild-type (WT) and Olfr154 knockout (KO) mice, preferably littermates to control for genetic background.

  • Include both males and females to account for potential sex differences in olfactory behaviors.

  • Ensure adequate sample sizes through power analysis (typically n=8-12 per group).

  • Control for age, as olfactory sensitivity can change throughout development and aging.

Experimental Design Structure:

  • Implement a completely randomized design (CRD) when testing homogeneous groups of mice with minimal covariates.

  • Consider randomized block design (RBD) to control for known sources of variation such as litter effects or testing day.

  • For complex designs with multiple factors (e.g., genotype, sex, odorant concentration), use factorial designs to assess interaction effects .

  • When appropriate, use Latin square designs to control for sequence effects in repeated measures protocols .

Behavioral Assays:

  • Two-choice odor preference test: Present mice with a choice between two odor samples and measure investigation time for each. This approach has been effectively used to assess attraction or aversion behaviors in olfactory receptor knockout studies .

  • Odor detection threshold test: Determine the minimum odorant concentration that elicits a behavioral response, as performed with muscone in MOR215-1 knockout mice .

  • Habituation/dishabituation test: Measure the decrease in investigation time with repeated presentations of the same odor (habituation) and the recovery of investigation when a new odor is presented (dishabituation).

  • Conditioned odor aversion: Pair odors with aversive stimuli to assess learned olfactory behaviors.

Control Measures:

  • Include positive controls (odors known to be detected by mechanisms independent of Olfr154).

  • Implement negative controls (vehicle only, no odor).

  • Randomize the order of odor presentation and position of odor sources.

  • Use double-blind testing procedures to prevent experimenter bias.

Data Analysis:

  • For threshold determination, use signal detection theory to calculate d' values.

  • Apply mixed-effects models to account for repeated measures and random effects.

  • Perform appropriate corrections for multiple comparisons.

This comprehensive experimental design approach allows for robust assessment of Olfr154's specific contribution to odor-induced behaviors while controlling for confounding variables .

How can researchers differentiate between the functions of Olfr154 and other closely related olfactory receptors?

Differentiating the functions of Olfr154 from closely related olfactory receptors requires a multi-faceted approach that addresses the inherent challenges of receptor redundancy and sequence similarity:

Genetic Approaches:

  • Single and double knockout comparisons: Generate and compare phenotypes of Olfr154 single knockouts with knockouts of related receptors and double knockouts containing Olfr154 plus related receptor deletions. This strategy can reveal compensatory mechanisms and functional redundancy, similar to studies with MOR215-1 and MOR214-3 .

  • Conditional and inducible knockout systems: Use Cre-loxP systems to delete Olfr154 in specific OSN populations or at different developmental stages to assess temporal aspects of receptor function.

  • Receptor swap experiments: Replace the Olfr154 coding sequence with that of related receptors to determine if the effects are due to receptor identity or expression pattern.

Functional Characterization:

  • Detailed dose-response profiling: Determine activation thresholds for Olfr154 and related receptors across a panel of odorants. Subtle differences in sensitivity or efficacy can distinguish receptor functions, as demonstrated in studies of Z5-14:OH detection by Olfr288 versus other receptors .

  • Temporal response characteristics: Measure activation and adaptation kinetics, which may differ between closely related receptors despite similar ligand profiles.

  • Signal transduction pathway analysis: Investigate potential differences in downstream signaling cascades activated by Olfr154 versus related receptors.

Anatomical and Circuit-Level Approaches:

  • High-resolution mapping of glomerular projections: Label Olfr154-expressing neurons and their axonal projections to identify specific glomeruli in the olfactory bulb. Compare these with projections from neurons expressing related receptors.

  • Circuit tracing: Use trans-synaptic tracers to map the central projections of Olfr154-associated glomeruli compared to those of related receptors.

  • Functional imaging of glomerular responses: Conduct in vivo calcium imaging to compare activation patterns of glomeruli associated with Olfr154 and related receptors in response to various odorants .

Computational and Structural Biology:

  • Sequence-function relationship analysis: Identify key amino acid residues that differ between Olfr154 and related receptors through site-directed mutagenesis.

  • Homology modeling and molecular dynamics simulations: Predict structural differences in the ligand-binding pockets of Olfr154 versus related receptors.

Quantitative Data Analysis:
Table 1: Comparative Receptor Analysis Framework

ParameterOlfr154Related Receptor 1Related Receptor 2Analysis Method
EC50 values for key odorants[data][data][data]Dose-response curves
Detection thresholds in behavioral assays[data][data][data]Two-choice tests
Glomerular activation patterns[data][data][data]Calcium imaging
Adaptation kinetics[data][data][data]Electrophysiology
Downstream signaling efficacy[data][data][data]cAMP/IP3 assays

This integrated approach allows researchers to systematically isolate the specific contributions of Olfr154 despite the high degree of homology and potential functional overlap with other olfactory receptors in the mouse genome .

What statistical methods are most appropriate for analyzing data from Olfr154 knockout studies?

The selection of appropriate statistical methods for analyzing data from Olfr154 knockout studies depends on the experimental design and the nature of the collected data. Following are the recommended approaches:

For Behavioral Data Analysis:

  • Two-sample t-tests or Mann-Whitney U tests: Compare simple metrics (e.g., investigation time) between wild-type and Olfr154 knockout mice when data meet parametric or non-parametric assumptions, respectively.

  • Analysis of Variance (ANOVA): For complex experimental designs with multiple factors:

    • Two-way ANOVA for analyzing genotype × odorant concentration interactions

    • Repeated measures ANOVA for longitudinal data or when testing multiple concentrations on the same animals

    • Mixed-effects models when including random factors such as litter or cage effects

  • Post-hoc tests: Apply Tukey's HSD, Bonferroni, or Šidák corrections for multiple comparisons to control Type I error rates.

  • Non-parametric alternatives: Use Kruskal-Wallis tests followed by Dunn's post-hoc tests when data violate parametric assumptions.

For Molecular and Cellular Data:

  • Generalized Linear Models (GLMs): Analyze count data (e.g., number of activated glomeruli) using Poisson or negative binomial distributions as appropriate.

  • Threshold determination analyses: Apply psychometric curve fitting to determine detection thresholds, as has been done with other olfactory receptor knockout studies .

  • Correlation analyses: Use Pearson's or Spearman's correlation to assess relationships between receptor expression levels and functional readouts.

For Imaging Data:

  • Region of interest (ROI) analyses: Compare fluorescence intensity changes in defined anatomical structures between genotypes.

  • Spatial pattern analyses: Apply principal component analysis (PCA) or other dimensionality reduction techniques to characterize differences in activation patterns.

  • Time series analyses: Use functional data analysis approaches to characterize temporal dynamics of neural responses.

Sample Size and Power Considerations:

  • Conduct a priori power analyses to determine adequate sample sizes, typically aiming for 80-90% power to detect effect sizes based on preliminary data or literature.

  • Consider sequential testing approaches with pre-defined stopping rules for behavioral experiments to minimize animal usage while maintaining statistical power.

  • Report effect sizes and confidence intervals alongside p-values to provide a more complete statistical picture.

Model Validation and Robustness:

  • Verify model assumptions (normality, homogeneity of variance) using appropriate diagnostic tests.

  • Perform sensitivity analyses to ensure findings are robust to analytical choices.

  • Consider bootstrap or permutation approaches when parametric assumptions cannot be met.

Table 2: Statistical Approach Selection Guide for Olfr154 Studies

Data TypeComparison TypeRecommended Primary AnalysisAlternative ApproachRequired Sample Size*
Detection thresholdsBetween genotypesProbit/Logit analysisChi-square tests8-12 mice/group
Investigation timesBetween genotypes × concentrationsTwo-way ANOVAMixed-effects model10-15 mice/group
Glomerular activationBetween genotypesTwo-sample t-test or Mann-WhitneyBootstrapping6-8 mice/group
Calcium imaging time-seriesResponse dynamicsFunctional data analysisArea under curve comparison5-7 mice/group

*Sample sizes are approximate and should be verified through power analysis for specific experimental parameters .

How can researchers effectively compare Olfr154 function across different mouse strains?

Comparing Olfr154 function across different mouse strains requires careful experimental design and analytical approaches to account for strain-specific differences in olfactory physiology and behavior:

Experimental Design Considerations:

  • Backcrossing strategy: Transfer the Olfr154 knockout to different strain backgrounds through at least 6-10 generations of backcrossing to ensure genetic homogeneity, monitoring by SNP analysis to verify background purity.

  • Control selection: Generate wild-type and knockout littermates within each strain background to control for maternal effects and minimize environmental variables.

  • Balanced design: Implement a randomized block design with strain and genotype as main factors, ensuring equal representation and statistical power across all experimental groups .

  • Environmental standardization: Maintain identical housing, testing conditions, and experimental protocols across all strains to minimize extraneous variables.

Phenotypic Characterization Approaches:

  • Hierarchical assessment: Begin with baseline characterization of olfactory epithelium morphology and receptor expression before proceeding to functional and behavioral analyses.

  • Standardized assays: Employ identical behavioral paradigms across strains, with consideration for strain-specific behavioral tendencies (e.g., adjusting test parameters to account for different activity levels or anxiety-like behaviors).

  • Multiple behavioral measures: Assess Olfr154 function across different behavioral contexts (e.g., spontaneous investigation, conditioned responses, innate behaviors) to capture the full spectrum of potential strain differences.

Molecular and Physiological Analyses:

  • Expression profiling: Quantify Olfr154 expression levels in each strain background using qPCR or RNA-seq, normalizing to strain-specific housekeeping genes.

  • Electro-olfactogram (EOG) recordings: Measure olfactory sensory neuron responses to Olfr154 ligands in different strain backgrounds to assess peripheral sensitivity.

  • Calcium imaging: Compare odorant-evoked responses in identified glomeruli across strains, similar to approaches used for other olfactory receptors .

Statistical Analysis Approaches:

  • Two-way ANOVA: Analyze main effects of strain and genotype, as well as their interaction, to determine strain-specific impacts of Olfr154 deletion.

  • Mixed-effects models: Account for random effects such as litter, testing cohort, or day of experimentation.

  • Multiple comparison corrections: Apply appropriate corrections (e.g., Bonferroni, Tukey HSD) when comparing across multiple strains.

  • Effect size calculations: Compute standardized effect sizes (e.g., Cohen's d, partial η²) to facilitate meaningful comparisons of Olfr154 effects across strains with different baseline variability.

Table 3: Cross-Strain Comparison Framework for Olfr154 Function

StrainOlfr154 Expression LevelDetection Threshold WTDetection Threshold KOBehavioral ImpactCompensatory Mechanisms
C57BL/6J[data][data][data][data][data]
BALB/c[data][data][data][data][data]
129Sv[data][data][data][data][data]
FVB/N[data][data][data][data][data]

Genetic Interaction Analysis:

  • Identify strain-specific modifier genes through QTL analysis by creating F2 crosses between strains with different Olfr154 knockout phenotypes.

  • Perform RNA-seq comparison of the olfactory epithelium across strains to identify differentially expressed genes that might interact with Olfr154 function.

  • Validate candidate modifier genes through targeted approaches such as compound mutant analysis.

This comprehensive approach enables researchers to distinguish strain-specific effects from the core functions of Olfr154, providing insight into genetic modifiers that influence olfactory receptor function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.