Recombinant Mouse Olfactory receptor 181 (Olfr181)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery time, kindly consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, it is recommended to briefly centrifuge the vial to concentrate the contents at the bottom. Reconstitute the protein using deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol final concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please specify it during order placement, and we will prioritize its inclusion.
Synonyms
Olfr181; Mor184-4; Olfactory receptor 181; Olfactory receptor 184-4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-317
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Olfr181
Target Protein Sequence
MMKANHSLTVEFILIGFSDHTDLKTLLFLLFSAIYLVTIVGNLGLVALIYMEPRLHTPMY IFLGNLALMDSCCSCAITPKMLENFFSVDRRISLYECMVQFYFLCLAETADCFLLAAMAY DRYVAICNPLQYHTMMSKKLSIQMSIGTFIASNLHSLIHTGCLLRLNFCKSRRIDHFFCD ILPLYKLSCTDPFINELMLYIFSMPIQVFTITTVLVSYSCILLTVFKMKSKDGRGKAFST CASHFFSVSIFYICLLMYIGPSKNSNKDIPVGVFYTIVIPLLNPFIYSLRNKEVVNAVKK VMKTHSIFKNSSASIAH
Uniprot No.

Target Background

Function
Potential odorant receptor.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Olfr181 and what role does it play in the mouse olfactory system?

Olfr181 (M71) is an odorant receptor (OR) expressed in olfactory sensory neurons (OSNs) within the mouse olfactory epithelium. This receptor mediates the interaction between odorous compounds and OSNs, serving as both a molecular receptor for specific odorants and a determinant for axonal targeting to specific glomeruli in the olfactory bulb. The dual role of Olfr181 in both odorant detection and axonal guidance makes it a valuable model for studying the molecular basis of olfactory perception and circuit formation .

Research methodologies for investigating Olfr181 function typically involve gene-targeted mouse models, calcium imaging techniques to measure neuronal responses, and anatomical tracing of axonal projections. By studying receptors like Olfr181, researchers have established that ORs determine both the odorant specificity of neurons and guide the convergence of functionally similar afferents to form particular glomeruli in the olfactory bulb .

How can I identify neurons expressing Olfr181 in tissue preparations?

The identification of Olfr181-expressing neurons can be achieved through several complementary approaches:

  • Fluorescent reporter systems: The most efficient method involves using gene-targeted mice in which the Olfr181 locus has been modified to co-express a fluorescent marker. For example, researchers have generated M71-IRES-tauGFP (M71-G) mouse lines where an internal ribosome entry site (IRES) and the coding sequence for tauGFP are inserted downstream of the M71 coding sequence. This creates a bicistronic mRNA that allows for the translation of both the receptor and the fluorescent marker without altering the receptor's coding sequence .

  • Immunohistochemistry: When fluorescent reporter mice are unavailable, immunostaining using antibodies against Olfr181 can be employed, though this approach may be limited by antibody specificity.

  • In situ hybridization: This technique can detect Olfr181 mRNA in tissue sections, allowing for the visualization of receptor expression patterns throughout the olfactory epithelium.

For live cell identification during functional experiments, the fluorescent reporter approach is most advantageous as it enables the selection of fluorescently labeled neurons for calcium imaging or electrophysiological recordings without compromising cellular viability .

What are the known ligands for Olfr181 and how were they identified?

Known ligands for Olfr181 (M71) include:

CompoundRelative EfficacyIdentification Method
AcetophenoneHighCalcium imaging in identified M71-expressing neurons
BenzaldehydeHighCalcium imaging in identified M71-expressing neurons

These agonists were identified using calcium imaging techniques in genetically identified OSNs from mice where M71-expressing neurons were labeled with GFP. The researchers systematically tested various odorant mixtures and individual compounds to characterize the response properties of these neurons .

The identification process typically involves:

  • Isolation of fluorescently labeled M71-expressing neurons from gene-targeted mice

  • Loading these neurons with calcium-sensitive dyes

  • Exposing the neurons to candidate odorants while monitoring intracellular calcium changes

  • Analyzing response profiles across multiple neurons and concentrations

This methodology has revealed that M71-expressing neurons consistently respond to acetophenone and benzaldehyde, demonstrating functional similarity across neurons expressing this particular receptor .

How should I design experiments to investigate Olfr181 function in vivo?

Designing robust experiments to investigate Olfr181 function requires careful consideration of several key factors:

  • Experimental group design: Implement a true experimental design with control and experimental groups. For Olfr181 studies, this typically involves comparing wild-type mice with gene-targeted mice expressing modified versions of the receptor or reporter constructs .

  • Variable identification and control:

    • Independent variables: Receptor expression (wild-type vs. modified), odorant identity, odorant concentration

    • Dependent variables: Neuronal response amplitude, activation threshold, glomerular targeting pattern

    • Control for extraneous variables: Genetic background, age, sex, housing conditions, and testing environment

  • Randomization: Randomly assign animals to experimental groups to control for potential genetic variations and ensure that observed effects are attributable to the manipulated variables rather than pre-existing differences .

  • Sample size determination: Calculate appropriate sample sizes based on expected effect sizes, desired statistical power, and variability in the measures of interest.

  • Blinding procedures: Implement double-blind protocols where possible, particularly for subjective measurements like anatomical analyses.

A well-designed example from the literature involved replacing the M71 coding sequence with that of the rat I7 OR, which changed the stimulus response profiles of the genetically defined OSN population and resulted in the formation of novel glomeruli in the olfactory bulb. This experimental approach demonstrated that ORs determine both odorant specificity and axonal convergence .

What controls should be included when performing calcium imaging experiments with Olfr181-expressing neurons?

Calcium imaging experiments with Olfr181-expressing neurons require several critical controls to ensure reliability and validity of results:

  • Viability controls:

    • KCl depolarization response: Apply KCl to verify that neurons are physiologically viable and capable of generating calcium signals

    • IBMX and forskolin stimulation: These compounds activate the olfactory signal transduction cascade downstream of the receptor, confirming the integrity of the signaling pathway

  • Specificity controls:

    • Vehicle controls: Apply the solvent used for odorant delivery without odorants to rule out mechanical or solvent-induced responses

    • Non-ligand odorants: Include odorants not expected to activate Olfr181 to confirm response specificity

    • Concentration series: Test a range of odorant concentrations to establish dose-response relationships and thresholds

  • Comparative controls:

    • OMP-GFP neurons: Include recordings from a random population of mature OSNs (e.g., from OMP-GFP mice where all mature OSNs are labeled) to establish baseline response profiles for comparison

    • Other identified OR populations: Compare responses of Olfr181-expressing neurons with those expressing other characterized ORs

  • Technical controls:

    • Ensure consistent dye loading across preparations

    • Control for photobleaching and phototoxicity during imaging

    • Maintain consistent stimulus delivery timing and concentration

Implementation of these controls helps distinguish receptor-specific responses from non-specific effects and ensures that observed differences in neuronal responses are attributable to the properties of Olfr181 rather than experimental artifacts .

How can I generate a recombinant Olfr181 expression system for in vitro studies?

Establishing a recombinant Olfr181 expression system for in vitro studies involves several methodological steps:

  • Vector design and construction:

    • Obtain the Olfr181 coding sequence from mouse genomic DNA or cDNA libraries

    • Design a mammalian expression vector with appropriate promoter (e.g., CMV) and selection markers

    • Consider incorporating epitope tags (e.g., FLAG, HA) for detection, ensuring they don't interfere with receptor function

    • Include trafficking enhancement sequences if necessary, as ORs often express poorly in heterologous systems

  • Cell line selection:

    • HEK293 cells are commonly used for OR expression

    • Consider specialized lines like Hana3A cells that express accessory factors to enhance OR surface expression

    • For more physiologically relevant systems, consider immortalized olfactory cell lines

  • Transfection optimization:

    • Test multiple transfection reagents and conditions

    • Establish stable cell lines through antibiotic selection for consistent expression

    • Verify expression through Western blotting, immunofluorescence, or flow cytometry

    • Assess membrane localization to confirm proper trafficking

  • Functional validation:

    • Implement calcium imaging or cAMP assays to measure receptor activation

    • Test known ligands (acetophenone and benzaldehyde) at various concentrations

    • Compare response profiles with those observed in native neurons

For enhancing surface expression and functionality, co-expression with receptor trafficking proteins (RTPs), receptor expression enhancing proteins (REEPs), or olfactory G-protein (Golf) may be necessary. Additionally, reducing the incubation temperature (33°C instead of 37°C) during expression can sometimes improve surface localization of olfactory receptors in heterologous systems.

How can gene targeting be used to manipulate Olfr181 expression and function?

Gene targeting offers powerful approaches for manipulating Olfr181 expression and function to investigate various aspects of olfactory system biology:

  • Reporter tagging strategies:

    • IRES-based approaches: Inserting an IRES sequence followed by a reporter gene (e.g., tauGFP) downstream of the Olfr181 coding sequence allows for the visualization of receptor-expressing neurons without altering receptor coding

    • Example implementation: M71-IRES-tauGFP mice express both the native M71 receptor and the fluorescent marker tauGFP from the same mRNA, enabling identification of M71-expressing neurons while preserving receptor function

  • Receptor swap experiments:

    • Coding sequence replacement: The Olfr181 coding sequence can be replaced with that of another OR (e.g., rat I7) while maintaining the Olfr181 locus control regions

    • This approach allows researchers to investigate how receptor identity influences both odorant response properties and axonal targeting

    • In previous studies, replacing M71 with rat I7 changed both the stimulus response profiles of the OSNs and resulted in the formation of novel glomeruli in the olfactory bulb

  • Conditional expression systems:

    • Cre-loxP systems can be employed to control the timing and cell-specificity of Olfr181 expression

    • Inducible promoters (e.g., tetracycline-regulated) allow for temporal control of receptor expression

  • Targeted mutations:

    • Site-directed mutagenesis of specific residues can identify amino acids critical for ligand binding or G-protein coupling

    • Creation of chimeric receptors by swapping domains between Olfr181 and other ORs can help map functional regions

For gene targeting in mice, the following methodological considerations are important:

  • Use of 129/Sv genomic fragments for constructing targeting vectors to ensure homologous recombination efficiency

  • Engineering of restriction sites (e.g., PacI) near the stop codon to facilitate insertion of reporter sequences

  • Verification of targeting through Southern blotting and PCR analysis

  • Backcrossing to desired genetic backgrounds to control for strain-specific effects

These gene targeting approaches have been instrumental in establishing that ORs like Olfr181 determine both odorant specificity and axonal convergence patterns in the olfactory system .

What methodologies are most effective for analyzing the axonal targeting of Olfr181-expressing neurons?

Analyzing the axonal targeting of Olfr181-expressing neurons requires a combination of genetic, imaging, and analytical approaches:

  • Genetic labeling strategies:

    • Expression of axonal markers: Using gene-targeted mice where Olfr181-expressing neurons co-express an axonal marker like tauGFP (e.g., M71-IRES-tauGFP) allows for the visualization of axonal projections and terminal fields

    • Sparse labeling techniques: Methods that label only a subset of Olfr181-expressing neurons can help resolve individual axonal trajectories

  • Imaging techniques:

    • Whole-mount imaging: Particularly useful for examining the dorsal surface of the olfactory bulb

    • Serial sectioning and reconstruction: Provides comprehensive analysis of glomerular targeting throughout the olfactory bulb

    • Confocal microscopy: Offers high-resolution imaging of axonal morphology and glomerular convergence

    • Light-sheet microscopy: Enables rapid imaging of axonal projections in whole, cleared specimens

  • Quantitative analysis methods:

    • Glomerular position mapping: Recording the coordinates of Olfr181-positive glomeruli relative to anatomical landmarks

    • Convergence analysis: Measuring the degree of axonal coalescence into discrete glomeruli

    • Comparative analysis: Assessing targeting differences between wild-type and modified Olfr181 expressions

  • Functional correlation:

    • Combining anatomical analyses with functional imaging (e.g., intrinsic signal imaging or calcium imaging of glomerular responses)

    • Correlating the positions of Olfr181-positive glomeruli with their odorant response properties

When implementing receptor swap experiments, such as replacing the M71 coding sequence with that of rat I7, researchers should examine how the change in receptor identity alters the location of glomerular targets. Previous work has demonstrated that such replacements result in the formation of novel glomeruli in the olfactory bulb, supporting the role of the receptor in determining axonal targeting specificity .

For reproducible analyses, it is essential to establish consistent criteria for identifying and characterizing glomeruli, including size thresholds, intensity measurements, and positional landmarks.

How can single-cell RNA sequencing be applied to study Olfr181-expressing neurons?

Single-cell RNA sequencing (scRNA-seq) offers powerful approaches for dissecting the molecular characteristics of Olfr181-expressing neurons at unprecedented resolution:

  • Cell isolation strategies:

    • FACS isolation: Using M71-IRES-fluorescent reporter mice to sort GFP-positive cells

    • Manual picking: Microscopically identifying and collecting fluorescently labeled cells

    • Microfluidic approaches: Capturing individual cells in droplets or wells

  • Experimental design considerations:

    • Include multiple biological replicates to account for individual variability

    • Consider developmental timepoints to track changes in gene expression profiles

    • Compare neurons expressing Olfr181 with those expressing other ORs to identify receptor-specific transcriptional signatures

    • Analyze both unstimulated cells and those exposed to known ligands (acetophenone, benzaldehyde) to identify activity-dependent changes

  • Analytical approaches:

    • Unsupervised clustering to identify potential subpopulations within Olfr181-expressing neurons

    • Differential expression analysis to identify genes specifically associated with Olfr181 expression

    • Gene ontology and pathway analyses to understand the biological functions of co-expressed genes

    • Pseudo-time trajectory analysis to explore maturation or activity-dependent changes

  • Research questions addressable through scRNA-seq:

    • Do all Olfr181-expressing neurons share the same transcriptional profile?

    • What signaling components and transcription factors are co-expressed with Olfr181?

    • How does odorant stimulation alter the transcriptome of Olfr181-expressing neurons?

    • Are there zonal differences in the transcriptional profiles of Olfr181-expressing neurons?

  • Validation and follow-up:

    • Confirm key findings using in situ hybridization or immunohistochemistry

    • Functional validation of newly identified genes through CRISPR editing or pharmacological approaches

When implementing scRNA-seq for Olfr181 studies, it's crucial to optimize RNA extraction and library preparation protocols for olfactory sensory neurons, which can be challenging due to their relatively small size and specialized morphology. Additionally, computational analyses should account for the monoallelic expression pattern of ORs and the potential impact of odorant exposure on transcriptional profiles.

How should I analyze calcium imaging data from Olfr181-expressing neurons?

Analyzing calcium imaging data from Olfr181-expressing neurons requires a systematic approach to ensure reliable and meaningful interpretation:

  • Pre-processing steps:

    • Background subtraction to remove autofluorescence and camera noise

    • Photobleaching correction to account for signal decay over time

    • Motion correction if cell movements occur during imaging

    • Region of interest (ROI) definition around individual cells or cellular compartments

    • Conversion of fluorescence intensity to relative measures (e.g., ΔF/F0 or ΔF/F)

  • Response quantification:

    • Amplitude measurement: Peak response relative to baseline

    • Temporal dynamics: Rise time, decay time, and response duration

    • Area under the curve analysis for integrated response measurement

    • Threshold determination to differentiate true responses from noise

  • Statistical analysis approach:

    • Compare responses to different odorants or concentrations using appropriate statistical tests

    • For M71-expressing neurons, determine consistency of responses across multiple cells to establish receptor-specific response profiles

    • Implement correction for multiple comparisons when testing numerous odorants

  • Data visualization methods:

    • Heat maps displaying response magnitudes across multiple cells and odorants

    • Response profile plots showing concentration-response relationships

    • Principal component analysis to identify patterns in response properties

When analyzing data from experiments with M71-expressing neurons, it's important to assess both the selectivity and sensitivity of responses. Previous studies have shown that M71-expressing neurons consistently respond to acetophenone and benzaldehyde, with minimal responses to other tested compounds . This response profile can serve as a positive control when assessing the function of recombinant or modified versions of the receptor.

What are the common challenges in interpreting Olfr181 ligand binding studies and how can they be addressed?

Interpreting Olfr181 ligand binding studies presents several challenges that require careful methodological considerations:

  • Signal-to-noise ratio issues:

    • Challenge: Distinguishing true responses from background fluctuations, especially with weak ligands

    • Solution: Implement multiple repetitions of stimulus application, use statistical thresholding based on baseline variability, and employ positive controls (known ligands like acetophenone and benzaldehyde) to establish response benchmarks

  • Concentration-dependent effects:

    • Challenge: Different concentrations of the same odorant can produce qualitatively different responses

    • Solution: Test multiple concentrations (typically spanning at least 3-4 log units) to establish complete dose-response curves and determine both threshold concentrations and EC50 values

  • Vehicle and mechanical artifacts:

    • Challenge: Solvent effects or mechanical stimulation from solution application can produce false positives

    • Solution: Include vehicle-only controls and implement consistent stimulus delivery methods (e.g., automated perfusion systems)

  • Receptor desensitization:

    • Challenge: Repeated or prolonged exposure to agonists can lead to decreased responsiveness

    • Solution: Allow sufficient recovery time between stimulations (typically 2-3 minutes), randomize stimulus order, and monitor response stability to repeated applications of the same stimulus

  • Indirect vs. direct activation:

    • Challenge: Determining whether responses result from direct receptor activation or secondary mechanisms

    • Solution: Compare response patterns in heterologous expression systems (where only Olfr181 is present) with those in native neurons, and test antagonists that block specific signaling pathways

  • Response variability across neurons:

    • Challenge: Individual Olfr181-expressing neurons may show different response magnitudes

    • Solution: Record from multiple neurons (n ≥ 10-15) and analyze population-level response statistics to establish reliable response profiles

A systematic analysis framework should include:

  • Standardized criteria for response classification

  • Comparison with known Olfr181 ligands (acetophenone and benzaldehyde) as positive controls

  • Statistical comparison with responses from neurons expressing other ORs or non-selective OSN populations

  • Validation of key findings using orthogonal approaches (e.g., electrophysiology or biochemical binding assays)

By addressing these challenges methodically, researchers can generate more reliable and interpretable data regarding Olfr181 ligand interactions and receptor activation properties.

How do I resolve contradictory findings in Olfr181 research?

Resolving contradictory findings in Olfr181 research requires a systematic approach to identify sources of variability and reconcile divergent results:

  • Methodological differences analysis:

    • Compare experimental protocols in detail, including:

      • Genetic backgrounds of mouse models

      • Methods for identifying Olfr181-expressing cells

      • Techniques for measuring receptor activation (calcium imaging vs. electrophysiology)

      • Odorant delivery systems and concentration calculations

      • Data analysis pipelines and response criteria

  • Technical variables assessment:

    • Evaluate potential sources of technical variability:

      • Purity and source of odorant compounds

      • Solution preparation methods and storage conditions

      • Recording conditions (temperature, pH, ionic composition)

      • Imaging parameters (exposure time, acquisition rate, resolution)

  • Biological factors consideration:

    • Investigate biological sources of variability:

      • Age and sex of experimental animals

      • Developmental stage of OSNs

      • Expression level of Olfr181 in different models

      • Zone of expression within the olfactory epithelium

      • Potential compensatory mechanisms in genetically modified models

  • Direct replication and validation:

    • Perform side-by-side comparisons of contradictory protocols

    • Implement both methodologies in the same laboratory environment

    • Test whether discrepancies persist when controlling for identified variables

    • Employ orthogonal techniques to validate key findings

  • Statistical and meta-analytical approaches:

    • Conduct power analyses to determine if sample sizes were adequate

    • Evaluate statistical methods used in contradictory studies

    • Perform meta-analyses when multiple studies address the same question

    • Consider Bayesian approaches to integrate evidence from multiple sources

  • Collaborative resolution strategies:

    • Organize collaborative experiments between laboratories reporting contradictory results

    • Develop standardized protocols and materials to be shared across research groups

    • Establish common data repositories and analysis pipelines

When addressing specific contradictions in Olfr181 research, it can be helpful to construct a comparison table that explicitly identifies points of agreement and disagreement across studies. This approach can reveal patterns that suggest whether discrepancies are due to methodological differences, technical variables, or fundamental biological heterogeneity.

For example, if studies disagree about whether a particular odorant activates Olfr181, systematically comparing the source and purity of the odorant, the concentration range tested, the method of activation measurement, and the response criteria may reveal the source of the contradiction.

What are common challenges when working with recombinant Olfr181 and how can they be overcome?

Working with recombinant Olfr181 presents several technical challenges that require specific troubleshooting strategies:

  • Poor surface expression:

    • Challenge: Olfactory receptors often fail to traffic efficiently to the cell membrane in heterologous systems

    • Solutions:

      • Co-express receptor trafficking proteins (RTPs) and receptor expression enhancing proteins (REEPs)

      • Include N-terminal trafficking tags (e.g., rhodopsin or serotonin receptor sequences)

      • Culture cells at lower temperature (33°C) to improve folding and trafficking

      • Use specialized cell lines optimized for OR expression (e.g., Hana3A cells)

  • Ligand identification difficulties:

    • Challenge: Determining specific ligands for orphan or poorly characterized receptors

    • Solutions:

      • Begin with known Olfr181 ligands (acetophenone and benzaldehyde) to validate the system

      • Test structurally related compounds to establish structure-activity relationships

      • Employ high-throughput screening approaches with diverse odorant libraries

      • Use computational modeling to predict potential ligands based on receptor structure

  • Signal detection issues:

    • Challenge: Weak or variable responses even with known ligands

    • Solutions:

      • Optimize signal detection by trying multiple assay formats (calcium imaging, cAMP assays, BRET-based approaches)

      • Increase sensitivity by using amplification steps (e.g., AC-cAMP-PKA-CREB pathway reporters)

      • Ensure appropriate G-protein coupling by co-expressing Golf or chimeric G-proteins

      • Implement signal averaging across multiple cells and repeated stimulations

  • Specificity confirmation:

    • Challenge: Determining whether responses are receptor-specific

    • Solutions:

      • Include non-transfected controls in all experiments

      • Create point mutations in the receptor to identify residues critical for ligand binding

      • Test structurally similar odorants to establish response specificity

      • Compare responses to those observed in native Olfr181-expressing neurons

  • Reproducibility across experiments:

    • Challenge: Variable results between experimental sessions

    • Solutions:

      • Standardize all aspects of the protocol, including cell density, transfection conditions, and assay parameters

      • Prepare larger batches of reagents to minimize lot-to-lot variability

      • Include positive controls (known ligands) and housekeeping measurements in each experiment

      • Normalize responses to internal standards to account for day-to-day variations

When working with recombinant systems, it's essential to validate their physiological relevance by comparing response properties with those observed in native Olfr181-expressing neurons. Previous studies using calcium imaging in identified M71-expressing OSNs provide benchmark data for such comparisons, particularly regarding responses to acetophenone and benzaldehyde .

How can I optimize calcium imaging protocols for studying Olfr181-expressing neurons?

Optimizing calcium imaging protocols for Olfr181-expressing neurons requires attention to several key technical parameters:

  • Neuronal preparation:

    • Dissociated culture approach:

      • Gentle dissociation methods to preserve cellular viability

      • Short culture periods (4-24 hours) to maintain native response properties

      • Substrate coating (e.g., concanavalin A, poly-D-lysine) to promote adherence while preserving cellular morphology

    • Tissue slice approach:

      • Appropriate slice thickness (300-400 μm) to maintain tissue integrity while allowing optical access

      • Proper oxygenation and temperature control during preparation and imaging

      • Minimize trauma to dendritic knobs and cilia where ORs are expressed

  • Dye selection and loading:

    • Calcium indicator selection:

      • Fura-2 AM for ratiometric measurements that control for bleaching and focus changes

      • Fluo-4 AM for higher sensitivity when signal-to-noise is limiting

      • GCaMP for genetic encoding when long-term imaging is required

    • Loading conditions:

      • Optimized dye concentration (typically 2-5 μM for AM dyes)

      • Appropriate loading time (30-60 minutes at room temperature)

      • Inclusion of dispersing agents (e.g., Pluronic F-127) to improve dye solubility

      • Thorough washing to remove extracellular dye

  • Imaging parameters:

    • Frame rate selection:

      • Fast acquisition (≥1 Hz) to capture rapid calcium transients

      • Balance between temporal resolution and photobleaching/phototoxicity

    • Exposure settings:

      • Minimize excitation intensity to reduce photodamage

      • Adjust gain and binning to improve signal while maintaining spatial resolution

    • Field selection:

      • Focus on regions with isolated, clearly identifiable fluorescent cells

      • Include multiple cells per field to increase throughput

  • Stimulus delivery:

    • Perfusion system optimization:

      • Laminar flow to ensure rapid and complete solution exchange

      • Minimal dead volume to reduce delay between valve switching and stimulus arrival

      • Flow rate adjustment to balance rapid delivery against mechanical stimulation

    • Odorant preparation:

      • Fresh solutions prepared from high-purity compounds

      • Serial dilutions in appropriate vehicles (e.g., mineral oil, DMSO)

      • Consistent concentration calculation methods

  • Controls and validation:

    • Viability controls:

      • KCl depolarization (50 mM) to confirm neuronal responsiveness

      • IBMX and forskolin application to verify intact signal transduction

    • Specificity controls:

      • Vehicle-only application to rule out mechanical artifacts

      • Application of known non-ligands to confirm specificity

When imaging M71-expressing neurons, it's important to establish response criteria based on the characteristic properties observed with known ligands (acetophenone and benzaldehyde). Previous studies have demonstrated that these neurons show consistent response profiles across different animals, providing a benchmark for protocol optimization .

What are best practices for maintaining validity and reproducibility in Olfr181 research?

Ensuring validity and reproducibility in Olfr181 research requires rigorous attention to experimental design, documentation, and analysis practices:

  • Experimental design principles:

    • Power analysis: Conduct a priori calculations to determine appropriate sample sizes

    • Randomization: Randomize the order of stimuli presentation and assignment of animals to experimental groups

    • Blinding: Implement blinding procedures during data collection and analysis to minimize bias

    • Controls: Include positive controls (known ligands), negative controls, and vehicle controls in all experiments

    • Independent replication: Verify key findings across multiple experimental sessions and, ideally, different investigators

  • Materials documentation and quality control:

    • Genetic resources:

      • Document the exact genetic background of mouse lines

      • Regularly validate genotypes through PCR and sequencing

      • Monitor for genetic drift in maintained colonies

    • Reagents and compounds:

      • Record source, lot number, and purity of all chemicals

      • Implement quality control testing for critical reagents

      • Document storage conditions and usage timeframes

  • Methodological standardization and reporting:

    • Detailed protocols:

      • Develop and follow standard operating procedures (SOPs)

      • Document all steps with sufficient detail for reproduction

      • Record deviations from established protocols

    • Comprehensive reporting:

      • Follow field-specific reporting guidelines (e.g., ARRIVE for animal studies)

      • Report all experimental conditions, including seemingly minor details

      • Provide raw data and analysis code where possible

  • Data management and analysis practices:

    • Data organization:

      • Implement consistent file naming and organization conventions

      • Maintain complete records of all experiments, including unsuccessful attempts

      • Establish secure backup systems for primary data

    • Analysis transparency:

      • Predefine analysis parameters and exclusion criteria

      • Document all analysis steps and software versions

      • Consider pre-registration of study designs and analysis plans

  • Response to variability and unexpected results:

    • Systematic investigation:

      • When facing unexpected results, systematically explore potential sources of variation

      • Document conditions that influence reproducibility

    • Comprehensive reporting:

      • Report both successful and failed replication attempts

      • Discuss sources of variability and their implications

A practical framework for maintaining reproducibility in Olfr181 research includes:

  • Creating detailed experiment templates that capture all relevant parameters

  • Implementing quality control checkpoints throughout experimental workflows

  • Establishing minimum reporting standards for methods and results

  • Developing shared resources and standardized protocols within research communities

For studies involving recombinant Olfr181, it's particularly important to validate the expression system by demonstrating responses to known ligands (acetophenone and benzaldehyde) that match those observed in native neurons . This validation provides an essential reference point for comparing results across different studies and experimental approaches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.