Recombinant Mouse Olfactory receptor 183 (Olfr183)

Shipped with Ice Packs
In Stock

Description

Pathway Involvement

Olfr183 belongs to the olfactory receptor family and participates in:

  • Olfactory Transduction: Binds odorants, activating cAMP-dependent signaling via Gα<sub>olf</sub> proteins .

  • Signal Transduction: Couples with G proteins to regulate ion channels and neuronal excitation .

PathwayAssociated Proteins
Olfactory transductionGNB1, ADRBK2, OR52B4
GPCR signalingOPRL1, DRD2L, TACR1A

Ligand Screening

While specific ligands for Olfr183 remain uncharacterized, analogous receptors like Olfr558 and Olfr90 respond to short-chain fatty acids (e.g., butyric acid) and fungal metabolites . Standard ligand identification methods include:

  • Luciferase reporter assays to detect cAMP elevation .

  • Calcium imaging for real-time receptor activation .

Experimental Uses

  • ELISA Development: Commercial kits utilize recombinant Olfr183 to quantify receptor expression in tissues (e.g., renal or olfactory epithelium) .

  • Structural Studies: His-tagged versions enable cryo-EM or X-ray crystallography to resolve ligand-binding pockets .

  • Gene Orthology Studies: Syntenic analysis places mouse Olfr183 within clusters orthologous to human chromosome 17p13.3, aiding evolutionary comparisons .

Evolutionary Context

Olfr183 is part of the MOR183 subfamily, which expanded independently in rodents. Orthology studies suggest conserved synteny with human OR clusters, though ligand specificity diverges due to species-specific adaptations .

Limitations and Future Directions

  • Ligand Unknowns: High-throughput screens are needed to deorphanize Olfr183 .

  • Tissue Localization: Current data lack clarity on extra-nasal expression (e.g., renal or testicular roles) .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please specify your requirement in the order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For working aliquots, store at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We determine the tag type during production. If you have a specific tag preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Olfr183; Mor183-2; Olfactory receptor 183; Olfactory receptor 183-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Olfr183
Target Protein Sequence
MEKKNETLWTEFVLTGLTCLPQWKPLLFLVFLVIYFMTIVGNLGLITLIWNDPHLHIPMY LFLSNLAFVDTWLSSTVTPRMLFNLLDKGKVISVAECKTQFFSFAISVTTECFLLAAMAY DRYAAICNPLLYPVIMTNRLCVRLLALSFIGGFLHAVIHESFLSRLTFCNSNIIYHFYCD VIPLLKISCTDPSLNYLIIFIFSGSIQVFTIMTVLISYTFVLFTILKKKSDKGIRKAFST CGAHLLSVSLYYGPLLFMYVHPASSEVDDQDMILSLFYTVIIPVLNPIIYSLRNKQVIDS LKKMLKMMV
Uniprot No.

Target Background

Function
This protein is a potential odorant receptor.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Mouse Olfactory Receptor 183 (Olfr183) and where is it typically expressed?

Olfr183 belongs to the largest gene family in the mouse genome, comprising nearly 1,000 genes. While traditionally associated with the olfactory epithelium, olfactory receptors like Olfr183 may also be expressed in non-olfactory tissues. To determine the expression profile of Olfr183, researchers typically use RT-PCR screening across multiple tissues including kidney, heart, skeletal muscle, lung, liver, stomach, and reproductive organs . This approach allows for characterization of tissue-specific expression patterns and potential physiological roles beyond olfaction.

How do researchers produce recombinant Olfr183 for in vitro studies?

Recombinant expression of olfactory receptors including Olfr183 is typically achieved through heterologous expression systems. A common approach involves:

  • Cloning the Olfr183 gene into expression vectors

  • Co-expression with G proteins (particularly Gαolf) to enable signal transduction

  • Addition of trafficking enhancers to improve surface expression

For functional studies, the Xenopus oocyte expression system has proven effective, requiring co-injection of cRNAs encoding the receptor, Gαolf, and a reporter such as CFTR (Cystic Fibrosis Transmembrane Regulator) . Alternatively, mammalian cell lines (HEK293, HeLa) can be used with appropriate modifications to enhance surface trafficking.

What are the main challenges in working with recombinant olfactory receptors like Olfr183?

Working with recombinant olfactory receptors presents several methodological challenges:

  • Poor surface trafficking in heterologous systems

  • Protein misfolding in non-native environments

  • Ligand identification complexity (most ORs remain "orphan" receptors)

  • Functional validation requirements

Surface expression can be monitored through fusion with fluorescent tags (GFP, RFP) and quantified using flow cytometry or microscopy. Trafficking enhancement strategies include the use of accessory proteins or creating chimeric receptors with better-expressed GPCRs .

What computational approaches can predict potential ligands for Olfr183?

In silico approaches for ligand prediction employ homology modeling and virtual ligand screening (VLS):

  • Create a homology model of Olfr183 based on available GPCR structures

  • Generate a grid map of the receptor binding pocket

  • Dock diverse odorant libraries against the model

  • Evaluate interactions using scoring functions that account for:

    • Hydrophobicity

    • Solvation electrostatics

    • Hydrogen bonding

    • Ligand deformation energy

    • Van der Waals interactions

The most promising candidates (those with more negative scores) can then be validated experimentally. This approach has successfully identified novel ligands for other olfactory receptors like MOR42-3 .

How can knockout (KO) models be utilized to study Olfr183 function in vivo?

Knockout models provide valuable insights into receptor function through loss-of-function analysis:

  • Generate Olfr183-KO mice using CRISPR/Cas9 or traditional gene targeting

  • Assess phenotypic changes in:

    • Olfactory function using behavioral tests

    • Tissue-specific effects if Olfr183 is expressed outside the olfactory epithelium

    • Molecular compensation by other olfactory receptors

Analysis should account for the burden effect observed with OR-KO genes, where the cumulative impact of multiple OR knockouts correlates with worsening odor discrimination capabilities .

Age GroupNumber of OR-KO GenesAverage Odor Discrimination ErrorsOlfactory Status
<65 years<50-1Normosmic
<65 years5-101-2Normosmic/Hyposmic
<65 years>102-4Hyposmic
≥65 yearsAny number2-4Hyposmic

Table 1: Relationship between age, OR-KO gene burden, and olfactory function based on patterns observed in human studies .

What are the current methods for deorphanizing Olfr183?

Deorphanization (identifying activating ligands) requires systematic screening approaches:

  • Heterologous Expression Functional Assays:

    • Luciferase reporter assays measuring cAMP elevation

    • Calcium imaging to detect receptor activation

    • Electrophysiological recordings in Xenopus oocytes

  • High-throughput Screening Strategies:

    • Screening diverse odorant libraries (~100-500 compounds)

    • Testing compounds at multiple concentrations (typically 500 μM for initial screens)

    • Categorizing potential ligands based on:
      a) Known agonists of related receptors
      b) Compounds found in biofluids
      c) Microbial metabolites
      d) Common odorants

  • Validation of Hit Compounds:

    • Dose-response relationships

    • Structure-activity analysis

    • Antagonist screening

What is the optimal protocol for expressing Olfr183 in Xenopus oocytes?

For functional expression in Xenopus oocytes:

  • Materials Preparation:

    • Generate expression constructs for Olfr183, Gαolf, and CFTR

    • Transcribe capped cRNAs using commercial kits (e.g., mMESSAGE MACHINE)

    • Prepare Barth's saline solution (88 mM NaCl, 1 mM KCl, 2.4 mM NaHCO3, 0.3 mM CaNO3, 0.41 mM CaCl2, 0.82 mM MgSO4, 15 mM HEPES, pH 7.6 with tetracycline)

  • Oocyte Injection:

    • Select stage V oocytes

    • Inject with cRNA mixture containing approximately 40 ng Olfr183, 10 ng Gαolf, and 1.5 ng CFTR cRNA

    • Incubate at 18°C for 2-5 days in Barth's solution

  • Functional Testing:

    • Prepare odorant solutions in appropriate vehicles (DMSO, ethanol, or directly in buffer)

    • Use electrophysiological recordings to measure CFTR-mediated currents in response to receptor activation

    • Include appropriate positive and negative controls

How should researchers design ligand screening experiments for Olfr183?

A comprehensive ligand screening approach includes:

  • Compound Library Design:

    • Include structurally diverse odorants

    • Incorporate ligands that activate phylogenetically related ORs

    • Include compounds present in biofluids (blood, urine)

    • Test microbial metabolites and environmental compounds

  • Screening Protocol:

    • Test compounds at 500 μM or highest tolerated concentration

    • Prepare stock solutions in DMSO (or appropriate vehicle)

    • Limit final DMSO concentration to 0.1% for agonist assays

    • Include positive controls (if available) and vehicle controls

    • Screen for both agonist and antagonist activity

  • Data Analysis:

    • Calculate signal-to-background ratios

    • Determine Z-factor to assess assay quality

    • Implement statistical thresholds for hit identification

    • Validate hits with dose-response curves

How should researchers interpret contradictory functional data for Olfr183?

When facing contradictory results in functional studies:

  • Methodological Comparison:

    • Examine differences in expression systems (mammalian cells vs. Xenopus oocytes)

    • Compare signaling readouts (calcium, cAMP, electrophysiology)

    • Assess receptor expression levels and trafficking efficiency

  • Experimental Conditions Analysis:

    • Evaluate buffer compositions and pH differences

    • Compare ligand preparation methods and storage conditions

    • Assess compound purity and potential degradation

  • Statistical Revaluation:

    • Determine appropriate statistical tests based on data distribution

    • Consider multiple testing corrections

    • Evaluate effect sizes rather than just p-values

Contradictions often arise from subtle methodological differences, particularly with olfactory receptors that may have multiple activation mechanisms or complex ligand interactions.

What bioinformatic approaches are useful for analyzing Olfr183 expression across tissues?

Comprehensive expression analysis involves:

  • RNA-Seq Analysis:

    • Process raw sequencing data using standard pipelines

    • Normalize expression values (FPKM, TPM)

    • Compare expression across tissues and conditions

    • Identify co-expressed genes for network analysis

  • Single-Cell Transcriptomics:

    • Characterize cell-type specific expression

    • Identify rare cell populations expressing Olfr183

    • Analyze developmental expression patterns

  • Comparative Analysis:

    • Cross-reference expression with other olfactory receptors

    • Evaluate conservation across species

    • Identify potential tissue-specific functions based on co-expression networks

For kidney-expressed ORs, systematic RT-PCR across multiple tissues has revealed unique expression profiles, suggesting distinct physiological roles beyond olfaction .

How might Olfr183 function outside the olfactory epithelium?

Olfactory receptors expressed in non-olfactory tissues may serve diverse physiological functions:

  • Potential Roles:

    • Chemical sensing of endogenous metabolites

    • Detecting microbial metabolites (e.g., short-chain fatty acids)

    • Regulating tissue-specific functions

    • Responding to environmental chemicals

  • Investigation Approaches:

    • Tissue-specific knockout studies

    • Transcriptomic analysis following receptor activation

    • Metabolomic screening for endogenous ligands

    • Physiological assays relevant to the specific tissue

The discovery that olfactory receptors like Olfr78 respond to microbial metabolites suggests potential roles in host-microbiome interactions . Similar functions might be explored for Olfr183 if expressed in tissues interfacing with the microbiome.

What is the impact of Olfr183 genetic variants on olfactory function?

Analysis of genetic variants requires:

  • Variant Identification:

    • Sequence Olfr183 in diverse populations

    • Identify Loss of Function (LoF) variants

    • Characterize missense variants affecting functional domains

  • Functional Assessment:

    • Test variant receptors in heterologous systems

    • Evaluate trafficking and ligand responses

    • Correlate genotypes with olfactory phenotypes

  • Population Analysis:

    • Calculate allele frequencies across populations

    • Assess evolutionary conservation

    • Evaluate potential selective pressures

Carriers of LoF variants in multiple olfactory receptor genes show impaired odor discrimination, with the effect more pronounced with increasing age and OR-KO burden .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.