Recombinant Mouse Olfactory receptor 186 (Olfr186)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Mouse Olfactory Receptors

Olfactory receptors (ORs) are G protein-coupled receptors (GPCRs) that detect odorants. Recombinant expression of mouse ORs enables functional characterization, ligand identification, and structural studies. Key methodologies include:

  • Fluorescent tagging (e.g., GFP fusion for biosynthesis tracking ).

  • Surface expression assays using tags like Flag to confirm plasma membrane localization .

  • Luciferase reporter systems to measure cAMP-mediated activation .

Ligand Screening and Functional Insights

Ligand identification for recombinant ORs involves:

  • Chemical libraries: Screens of odorant compounds (e.g., carboxylic acids for Olfr558 ).

  • Ortholog conservation: Human orthologs (e.g., OR51E1 for Olfr558) often share ligand profiles, suggesting evolutionary roles .

Example ligand profiles from related studies:

ReceptorStrong LigandsMicrobial/Fungal OriginTissue Distribution
Olfr558Butyric acid, isovaleric acidGut microbiotaKidney, liver, lung
Olfr902-methyl-4-propyl-1,3-oxathianeFungal metabolitesKidney, testes

Challenges in Recombinant OR Studies

  • Surface trafficking: Only ~70% of ORs traffic to the plasma membrane without chaperones like RTP1S .

  • Expression yield: Mammalian systems (e.g., HEK-293T) achieve ~10⁶ receptors per cell for structural studies .

Database and Genomic Context

The ESBL Olfactory Receptor Database catalogs 1,109 mouse ORs but does not list Olfr186. Notable entries include:

Mouse GeneHuman OrthologTissue Expression
Olfr558OR51E1Renal cortex, liver
Olfr1393OR51E2Kidney, testes

Research Gaps and Future Directions

While Olfr186 is not discussed in the provided literature, studies on other ORs suggest:

  • Functional redundancy: ORs with sequence similarity (e.g., Olfr601 and its paralogs ) may compensate in knockout models.

  • Non-sensory roles: Renal ORs detect microbial metabolites, implying systemic roles beyond olfaction .

Methodological Recommendations for Studying Olfr186

  1. Sequence analysis: Compare Olfr186 with deorphanized ORs (e.g., MOR256 subfamily ).

  2. Ligand libraries: Prioritize microbial or fungal metabolites based on trends in related receptors .

  3. Ortholog validation: Identify human orthologs (if any) to assess conserved functions.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Olfr186; Mor183-9; Olfactory receptor 186; Olfactory receptor 183-9
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Olfr186
Target Protein Sequence
MEDGNTTLLTEFVLTGLTDHQGLQVPLFLLFLMIYLITVVGNLGLIALIWSDPHLHIPMY LFLGSLAFVDAWISSAVTPNMLFDLLSKNKMISLSECMIQFFAFAFGGTTECFLLGTMAY DRYVAICKPLLYPVIMTNRLCIRLLVSVFIGGFLHSLFHVLFLLRLTFCNSNIIHHFYCD IIPLYNISCTDPTLNLLLVFILSGSIQVFTIMTVLVSYTLVLFTILKMKSLQGIRKAFST CGAHLLSVSLYYGPLLFMYVLPASQQTDGQGMMDSLFYTVIIPVLNPIIYSLRNKQVTDS LKKRLERHV
Uniprot No.

Target Background

Function
Potential odorant receptor.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Mouse Olfactory Receptor 186 (Olfr186) and how is it classified in the genome?

Olfr186 belongs to the large family of olfactory receptors (ORs), which constitute the largest family of sensory membrane proteins in mammals. It is classified as an olfactory receptor gene in the mouse genome with Gene ID 258318. The official gene symbol is OLFR186, and its protein is encoded by mRNA with RefSeq number NM_146321.1, resulting in the protein product with RefSeq number NP_666433.1 and UniProt ID Q8VEX5 . Olfactory receptors are G protein-coupled receptors (GPCRs) that play crucial roles in detecting and discriminating diverse odorous molecules. Understanding their molecular structure and classification provides the foundation for exploring their functional properties in sensory and non-sensory tissues.

How does Olfr186 compare structurally and functionally to other characterized mouse olfactory receptors?

While specific structural information for Olfr186 is limited, we can draw comparisons with other characterized mouse olfactory receptors such as mOR256-17, Olfr558, and Olfr90. Like other ORs, Olfr186 likely contains seven transmembrane domains characteristic of GPCRs. Functional characterization of other ORs, such as Olfr558 and Olfr90, has revealed their activation by specific ligands (e.g., carboxylic acids for Olfr558) . Methodologically, such functional comparisons require expression systems that enable sufficient receptor production and proper membrane trafficking, followed by ligand screening assays such as luciferase reporter assays that measure cAMP elevation upon receptor activation . These comparative analyses are essential for understanding the unique properties of Olfr186 within the broader context of olfactory receptor biology.

What is the tissue distribution profile of Olfr186 in mice, and how does it compare to other olfactory receptors?

While the search results don't provide specific information about Olfr186's tissue distribution, we can infer potential patterns based on studies of other olfactory receptors. Research on ORs such as Olfr90, Olfr558, and others has demonstrated expression in both sensory (olfactory epithelium) and non-sensory tissues (kidney, liver, heart, skeletal muscle, lung, stomach, reproductive organs) . These expression profiles suggest that ORs, including potentially Olfr186, may serve functions beyond olfaction. Methodologically, tissue distribution profiles can be determined using RT-PCR with gene-specific primers, as demonstrated for other ORs . For Olfr186 specifically, researchers would need to design primers that amplify unique sequences (typically 100-600 base pairs) of the Olfr186 gene, followed by gel extraction and sequencing to confirm specificity.

TissuesOlfr56Olfr90Olfr558Olfr461Olfr1033Olfr1034Olfr1396
Kidney62*66666
Liver-13--3-
Lung4-3231-
Heart3-1-4-1
Skeletal muscle-2-1-4-
Stomach2-1--1-
Testes222-11-
Uterus3241444

Note: This table represents expression patterns of other ORs and is provided as a reference for potential Olfr186 distribution studies .

What expression systems are most effective for producing recombinant Olfr186, and what yields can be expected?

Based on research with other olfactory receptors, mammalian expression systems are generally most effective for producing functional ORs. For instance, mOR256-17 was successfully expressed in transiently transfected mammalian cells, yielding approximately 10^6 receptors per cell . For Olfr186 specifically, expression has been achieved in HEK293 cells as indicated by commercially available recombinant products . When designing expression systems for Olfr186, researchers should consider codon optimization, signal sequence modification, and trafficking-enhancement strategies that have proven successful with other ORs. Methodologically, this requires construction of expression vectors containing the Olfr186 coding sequence with appropriate regulatory elements and selection markers. Quantification of expression can be performed using fluorescent tagging approaches similar to those used for mOR256-17, where GFP fusion to the C-terminus allows quantification of total OR biosynthesis, while N-terminal tagging permits visualization of receptors at the plasma membrane .

What strategies can improve the membrane trafficking of recombinant Olfr186?

Membrane trafficking of olfactory receptors represents a significant challenge in recombinant expression systems. For Olfr186, researchers should consider several strategies that have proven effective with other ORs: (1) N-terminal modification with trafficking-enhancement tags such as the first 20 amino acids of rhodopsin; (2) co-expression with accessory proteins like receptor transporting proteins (RTPs) and receptor expression enhancing protein (REEP); (3) culture at reduced temperatures (e.g., 30°C) to facilitate protein folding; and (4) addition of chemical chaperones like glycerol or dimethyl sulfoxide to the culture medium. Methodologically, the effectiveness of these strategies can be assessed using fluorescence microscopy of tagged receptors or flow cytometry approaches, as demonstrated for other ORs like mOR256-17, where post-translational fluorescence labeling of a 12-amino acid polypeptide sequence at the N-terminus allowed selective visualization and quantification of ORs at the plasma membrane .

What purification methods are optimal for isolating recombinant Olfr186 while maintaining its functional integrity?

Purification of membrane proteins like Olfr186 requires careful consideration of detergent selection and stabilization strategies. Based on approaches used for other GPCRs, effective purification of functional Olfr186 would likely involve: (1) solubilization using mild detergents such as n-dodecyl-β-D-maltoside (DDM) or lauryl maltose neopentyl glycol (LMNG); (2) affinity chromatography using tags like polyhistidine or FLAG; and (3) size exclusion chromatography for final polishing. To maintain functional integrity, addition of cholesterol or other lipids during purification may be necessary. For recombinant Olfr186 specifically, one approach involves expression with His-tags or other affinity tags, as seen in commercially available products . These purification strategies must be optimized to balance yield with retention of native structure and function, which can be verified using ligand-binding assays or structural analysis techniques following purification.

What methods are most reliable for identifying ligands that activate Olfr186?

Ligand identification for olfactory receptors typically employs high-throughput screening approaches coupled with functional assays that measure receptor activation. Based on methodologies used for other ORs like Olfr558 and Olfr90, researchers investigating Olfr186 should consider luciferase reporter assays that measure cAMP elevation upon receptor activation . This approach takes advantage of the fact that ORs couple to stimulatory G proteins, elevating intracellular cAMP upon activation. Practically, cells expressing Olfr186 would be transfected with a firefly luciferase construct under the control of a cAMP response element, along with constitutively active Renilla luciferase for normalization. The ratio of firefly-to-Renilla luciferase signal provides an index of receptor activation . Compounds for screening should be selected based on: (1) known activators of related ORs; (2) compounds found in relevant biofluids; (3) molecules classified as "odorants" present in biofluids; and (4) small molecules produced by commensal or environmental microorganisms. Initial screening concentrations typically range from 100-500 μM or at the highest tolerated dose for toxic molecules .

How can researchers distinguish between direct ligand binding to Olfr186 and indirect activation through secondary pathways?

Distinguishing direct from indirect activation represents a methodological challenge in OR research. For Olfr186 studies, researchers should implement multiple complementary approaches: (1) Dose-response analysis to establish EC50 values, as direct interactions typically show consistent dose-dependent effects; (2) Structure-activity relationship studies using chemically related compounds to identify structural features critical for activation; (3) Binding assays using purified receptor and radiolabeled or fluorescently labeled ligands; (4) Competitive binding assays with known agonists; and (5) Site-directed mutagenesis of predicted binding pocket residues to confirm the binding interface. Additionally, heterologous expression in cell lines lacking endogenous signaling components of interest can help eliminate indirect activation mechanisms. These approaches collectively provide stronger evidence for direct ligand-receptor interactions versus downstream pathway effects.

What are the signaling pathways downstream of Olfr186 activation, and how can they be experimentally characterized?

While specific information about Olfr186 signaling is limited, olfactory receptors typically signal through Gαolf (a Gαs family member) to activate adenylyl cyclase, increase cAMP, and subsequently activate protein kinase A and the cyclic nucleotide-gated channels (in olfactory neurons). To characterize Olfr186 signaling pathways, researchers should employ: (1) ELISA or FRET-based assays to measure cAMP production following receptor activation; (2) Calcium imaging to detect intracellular calcium flux; (3) Phosphorylation-specific antibodies to monitor activation of downstream kinases; (4) siRNA knockdown or CRISPR-Cas9 knockout of specific signaling components to determine their necessity; and (5) Pharmacological inhibitors of specific pathway components. These approaches can map the complete signaling cascade initiated by Olfr186 activation and potentially identify unique features of this receptor's signaling compared to other ORs.

How can structural biology approaches be applied to understand the ligand-binding mechanism of Olfr186?

Advanced structural biology approaches for Olfr186 research should include: (1) Homology modeling based on structures of related GPCRs, with refinement using ligand docking simulations; (2) Site-directed mutagenesis of predicted binding pocket residues to experimentally validate the model; (3) Stabilization strategies for structural studies, including thermostabilizing mutations, fusion proteins, and antibody fragments; (4) Cryo-electron microscopy of purified receptor-ligand complexes; and (5) X-ray crystallography following successful crystallization trials. These approaches are technically challenging but could provide critical insights into the structural basis of Olfr186 ligand specificity. Methodologically, researchers should consider expressing Olfr186 with stabilizing fusion partners (e.g., T4 lysozyme or BRIL) inserted into intracellular loops to facilitate crystallization or cryo-EM studies. Complementary techniques such as hydrogen-deuterium exchange mass spectrometry or NMR spectroscopy of specific receptor domains can provide additional structural insights even in the absence of a complete structure.

What is the evolutionary relationship between mouse Olfr186 and potential human orthologs, and what functional implications does this have?

Evolutionary analysis of Olfr186 requires comparative genomics and functional approaches. Researchers should: (1) Perform phylogenetic analysis using OR sequences from multiple species to identify potential human orthologs; (2) Compare synteny relationships in genomic regions containing these genes; (3) Conduct sequence conservation analysis focusing on predicted ligand-binding regions; and (4) Express and functionally characterize both mouse Olfr186 and putative human orthologs using identical methodologies to directly compare ligand response profiles. This approach has been informative for other ORs such as mouse Olfr558, which has a human ortholog (OR51E1) with similar ligand profiles, suggesting evolutionarily conserved functions . Such evolutionary conservation analyses provide insights into the physiological significance of these receptors and their potential roles beyond traditional olfaction.

What role might Olfr186 play in non-olfactory tissues, and how can this be experimentally determined?

Investigation of Olfr186's non-olfactory functions requires a multi-faceted approach: (1) Comprehensive tissue expression profiling using quantitative RT-PCR, RNA-Seq, and immunohistochemistry to identify all tissues expressing Olfr186; (2) Single-cell RNA-Seq to determine the specific cell types expressing the receptor within each tissue; (3) Generation of tissue-specific conditional knockout models to assess functional consequences of receptor deletion; (4) Identification of tissue-specific ligands that may activate the receptor in non-olfactory contexts; and (5) Examination of physiological responses following receptor activation or inhibition in relevant tissues. Based on studies of other olfactory receptors found in non-olfactory tissues, potential roles for Olfr186 might include chemosensing of metabolites, regulation of cellular proliferation, or detection of microbial products . Specific experimental designs should account for the particular tissues in which Olfr186 is expressed and the physiological processes relevant to those tissues.

How can pre-coupled magnetic beads with recombinant Olfr186 be utilized for advanced research applications?

Pre-coupled magnetic beads with recombinant Olfr186, such as those described in the search results , offer versatile research applications: (1) Pull-down assays to identify novel interacting proteins in various tissues, potentially revealing tissue-specific signaling complexes; (2) Ligand fishing experiments to capture and identify novel ligands from complex biological samples; (3) Development of biosensors for detecting specific compounds in environmental or biological samples; (4) Antibody screening and characterization; and (5) Isolation of specific cell populations expressing complementary receptors or ligands. These magnetic bead constructs typically feature uniform particle size (approximately 2 μm) with hydrophilic surfaces and high binding capacity (>200 pmol rabbit IgG/mg beads) . Methodologically, researchers should optimize buffer conditions, incubation times, and washing steps to maximize specific interactions while minimizing background. Mass spectrometry can then be used to identify pulled-down proteins or compounds, followed by validation using alternative methods such as co-immunoprecipitation or direct binding assays.

What are the most common challenges in achieving functional expression of Olfr186, and how can they be addressed?

Functional expression of olfactory receptors including Olfr186 faces several challenges: (1) Poor membrane trafficking—addressed through trafficking enhancement tags, co-expression with chaperones like RTP1S and RTP2, and optimized signal sequences; (2) Protein misfolding—mitigated by reduced expression temperatures, chemical chaperones, and codon optimization; (3) Instability—improved using strategic disulfide bonds or thermostabilizing mutations; and (4) Low expression levels—enhanced by optimized promoters, codon usage, and expression vectors. Experimentally, researchers should implement a systematic approach, testing multiple expression constructs with different modifications in various cell lines. Expression can be monitored using Western blotting with antibodies against epitope tags or the receptor itself, flow cytometry of fluorescently tagged receptors, and functional assays measuring receptor activation by known or predicted ligands.

How should researchers address data inconsistencies when characterizing Olfr186 function across different experimental systems?

When confronting data inconsistencies in Olfr186 research, a methodical approach includes: (1) Standardizing expression systems and assay conditions across laboratories; (2) Carefully documenting receptor construct details, including any modifications, tags, or fusion proteins; (3) Employing multiple, complementary assay systems to measure receptor function; (4) Validating antibodies and other research tools rigorously; and (5) Implementing appropriate statistical analyses that account for variability in biological systems. Researchers should also consider factors that might affect receptor function differently across systems, such as membrane composition, expression of accessory proteins, post-translational modifications, and the presence of endogenous ligands in culture media. Publishing detailed methodologies and sharing research materials can facilitate cross-laboratory validation and resolution of inconsistencies.

What quality control measures should be implemented when working with recombinant Olfr186 preparations?

Rigorous quality control for recombinant Olfr186 preparations should include: (1) Verification of sequence integrity through DNA sequencing of expression constructs; (2) Confirmation of protein identity using mass spectrometry; (3) Assessment of purity using SDS-PAGE and Western blotting; (4) Validation of proper folding and membrane insertion using circular dichroism spectroscopy or limited proteolysis; (5) Functional validation through ligand-binding or activation assays; and (6) Stability testing under various storage conditions. For Olfr186 pre-coupled to magnetic beads, additional quality controls should include verification of coupling efficiency, batch-to-batch consistency, and maintenance of binding capacity . These measures ensure that experimental outcomes reflect the true properties of the receptor rather than artifacts introduced by variability in preparation quality.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.