Recombinant Mouse Olfactory receptor 187 (Olfr187)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Gene Information

Olfr187 is encoded by the Olfr187 gene (synonyms: Mor183-8) located in the mouse genome . Key structural features include:

  • Topology: A 7-transmembrane domain structure typical of GPCRs .

  • Post-Translational Features: High AU-content mRNA and low predicted secondary structure, common among olfactory receptors .

Recombinant Production and Purification

Recombinant Olfr187 is produced using heterologous expression systems:

ParameterDetails
Expression HostE. coli (with N-terminal His tag) or mammalian cells
Purity>90% (verified by SDS-PAGE)
Storage BufferTris/PBS-based buffer with 6% trehalose (pH 8.0)
Storage Conditions-20°C/-80°C (long-term); 4°C for working aliquots (≤1 week)
ReconstitutionDeionized water (0.1–1.0 mg/mL), with optional glycerol for stability

Functional expression in mammalian cells requires optimization due to challenges in OR trafficking and folding . Fluorescent tagging (e.g., GFP) has been used to quantify expression levels .

Olfactory Role

  • Olfr187 is expressed in mature olfactory sensory neurons (OSNs) of the main olfactory epithelium, where it localizes to cilia for odorant detection .

  • Spatial transcriptomics reveals that Olfr187’s distribution in the olfactory mucosa may correlate with odorant solubility, supporting the "chromatographic hypothesis" of odorant sorption .

Genetic and Epigenetic Regulation

  • DNA methylation in promoter regions influences expression levels of OR genes, as shown in studies on related receptors like Olfr17 .

  • Strain-specific differences (e.g., C57BL/6J vs. 129 mice) affect receptor expression, highlighting the impact of genetic background .

Research Applications

  • Ligand Screening: While specific ligands for Olfr187 remain unidentified, related ORs (e.g., Olfr558) are activated by microbial metabolites, suggesting potential roles in chemosensing .

  • Antibody Development: Commercial antibodies against Olfr187 enable immunohistochemical studies in olfactory tissues .

  • Structural Studies: High-yield recombinant production facilitates biophysical analyses of odorant-receptor interactions .

Challenges in Olfactory Receptor Research

  • Low Expression Yields: ORs like Olfr187 often require codon optimization or chaperone co-expression for proper folding in heterologous systems .

  • Cross-Reactivity: Antibody validation is critical, as some anti-OR antibodies exhibit nonspecific binding .

Comparative Genomics

  • Mice possess ~1,100 functional OR genes, far more than primates, underscoring their utility in olfactory research .

  • Human orthologs (e.g., OR51E1) share functional similarities with mouse ORs, enabling translational studies .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your needs whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type in mind, please inform us and we will prioritize its development.
Synonyms
Olfr187; Mor183-8; Olfactory receptor 187; Olfactory receptor 183-8
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Olfr187
Target Protein Sequence
MEKNATLLTEFVLTGLSHQPLWNIPLFLVFLVIYLITIVGNVSLITLIWTDPHLHIPMYL FLGSLAFVDTSISSIVVPKMLLNFFGKSKVITLSECMAQFFLFNISATTECFLLAAMAYD RYVAICKPLLYPVVMTNGLCVWLIALSFVAGIIHALIHEGFLLRLTFCNSNMIHNFYCDI ISLLKISCTDTSLNYLIVFIFSGSIQVFTISTILVSYTIILFTILKKKSAKGIKKAFSTC GAHLLSVSLYYGPLLFMYVHPASSEVDDQDMIDSLFYTVIIPVLNPIIYSLRNKQVIDSL AKFLKRNV
Uniprot No.

Target Background

Function
Potential odorant receptor.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Mouse Olfactory Receptor 187 and how is it characterized?

Mouse Olfactory Receptor 187 (Olfr187/Mor183-8) is a G-protein-coupled receptor (GPCR) with UniProt accession number Q8VEX6. The full-length protein comprises 308 amino acids and functions primarily as an odor sensor in the olfactory epithelium. Like other ORs, Olfr187 belongs to the largest GPCR family in mammals, characterized by seven transmembrane domains and coupling to G-proteins for signal transduction . The receptor's amino acid sequence includes specialized regions for ligand binding and signal transduction that determine its specificity for certain odorant molecules.

How do olfactory receptors like Olfr187 function in odor detection?

Olfactory receptors function through a G-protein coupled signaling cascade. When an odorant binds to the receptor's binding pocket, it triggers conformational changes that activate G-proteins, leading to increases in secondary messengers like cAMP. This activation can be measured through calcium imaging or reporter assays monitoring changes in cAMP signaling. Upon activation, ORs typically induce a transient increase in intracellular calcium concentration, which can be detected using various assay systems . The discriminative power of the olfactory system derives from the combinatorial activation patterns of different ORs by various odorants.

Beyond olfaction, what other physiological roles might Olfr187 play?

Recent research has revealed that ORs, initially characterized in the olfactory epithelium, are expressed in various non-sensory tissues, suggesting broader physiological functions. Systems biology approaches have identified significant changes in OR expression during kidney fibrosis progression, including several ORs like Olfr433, Olfr129, Olfr1393, and Olfr161 . Though Olfr187 specifically wasn't mentioned in this context, the findings support investigation into potential roles of ORs, including Olfr187, in non-olfactory tissues and pathological conditions. These non-canonical functions may include roles in cellular proliferation, migration, or metabolism regulation in various organs.

What are the most effective systems for recombinant expression of Olfr187?

Several expression systems have proven effective for recombinant OR production:

  • Mammalian cell expression: Transiently transfected mammalian cells (particularly HEK293 or Hana3A cells) can yield approximately 10^6 ORs per cell . Hana3A cells are particularly valuable as they express chaperon proteins like RTP1 or RTP2, olfactory G-protein, and rho tag that enhance proper folding and trafficking of ORs to the cell surface .

  • Xenopus laevis oocytes: This system has successfully expressed functional ORs, including human OR17-40, and allows for electrophysiological measurements of receptor activity .

  • Adenovirus-mediated expression systems: These have been utilized for in vivo expression in the olfactory epithelium, particularly valuable for studying receptor function in its native environment .

For Olfr187 specifically, expression in mammalian cells with appropriate chaperone proteins would likely yield the most functional protein for in vitro studies.

How can I optimize the expression and trafficking of recombinant Olfr187 to the cell surface?

Optimizing OR expression involves several strategies:

  • Co-expression with accessory proteins: Include receptor-transporting proteins (RTPs), receptor expression-enhancing proteins (REEPs), and Gα proteins to improve folding and trafficking.

  • N-terminal tagging: A 12-amino acid polypeptide sequence at the N-terminus allows for selective visualization and quantification of ORs at the plasma membrane using cell flow cytometry .

  • Rho-tagging: Adding a rhodopsin-derived sequence has been shown to improve surface expression of ORs.

  • Expression temperature modulation: Often, lower incubation temperatures (30-32°C) after transfection can improve folding and reduce degradation of ORs.

  • Cell line selection: Hana3A cells, which express chaperon proteins like RTP1 or RTP2, olfactory G-protein, and rho tag, have shown superior results for OR expression .

A dual-color labeling approach using GFP fusion at the C-terminus for total cellular OR biosynthesis monitoring and N-terminal tagging for surface expression quantification provides comprehensive data on expression efficiency .

What purification methods are most suitable for obtaining functional Olfr187?

Purification of membrane proteins like Olfr187 requires specialized approaches:

  • Detergent solubilization: Choose mild detergents (DDM, LMNG, or digitonin) that maintain receptor functionality.

  • Affinity chromatography: Using tags like His6, FLAG, or rho-1D4 for selective purification.

  • Size exclusion chromatography: For further purification and to ensure homogeneity.

  • Lipid reconstitution: Consider reconstituting the purified receptor into nanodiscs or liposomes to maintain functionality.

Storage in a Tris-based buffer with 50% glycerol has been recommended for recombinant ORs, with aliquots stored at -20°C or -80°C for extended storage to minimize freeze-thaw cycles .

What methods can be used to identify specific ligands for Olfr187?

Ligand identification for ORs involves systematic screening approaches:

  • Compound library screening: Testing libraries of odorants against cells expressing Olfr187. This approach identified 17 new agonists for Olfr73 from a virtual screening of 1.6 million compounds .

  • Calcium imaging: Measuring odorant-induced Ca²⁺ increases in cells expressing the receptor, which can detect specific ligand-receptor interactions .

  • SEAP reporter assay: Monitoring changes in cAMP second messenger signaling as a readout for odorant-induced receptor activation .

  • Electrophysiological recordings: Particularly in Xenopus oocytes expressing the receptor, measuring membrane conductance changes in response to potential ligands .

  • Virtual screening and molecular modeling: Computational approaches can predict potential ligands by docking compounds into modeled receptor binding pockets, as demonstrated for Olfr73 .

The strategy of subdividing odorant mixtures into progressively smaller groups has successfully identified specific ligands for other ORs and could be applied to Olfr187 .

How can I quantitatively assess Olfr187 activation in response to ligands?

Quantitative assessment of OR activation employs several complementary techniques:

  • Dose-response curves: Using increasing concentrations of potential ligands to determine EC₅₀ values.

  • Calcium flux assays: Using fluorescent calcium indicators (Fluo-4, Fura-2) to measure intracellular calcium changes upon receptor activation.

  • cAMP assays: FRET-based or luminescence-based (GloSensor, SEAP) assays to measure changes in cAMP levels.

  • Luciferase reporter systems: 41% of bioassay results in the OR field use luciferase assays with the Hana3A cell line .

  • Electrophysiology: Measuring changes in membrane conductance, particularly in Xenopus oocytes expressing the receptor .

Comparing responses to known active compounds can provide benchmarks for assessing the efficacy of new ligands, with data typically presented as concentration-response curves normalizing responses to a reference agonist.

How do I determine the binding pocket characteristics and ligand specificity of Olfr187?

Understanding binding pocket characteristics involves:

  • Homology modeling: Creating structural models based on related GPCRs with known crystal structures.

  • Molecular dynamics simulations: Exploring the flexibility and conformational changes of the binding pocket, which is particularly important as OR binding pockets tend to be smaller but more flexible than typical GPCRs .

  • Site-directed mutagenesis: Systematically mutating residues predicted to interact with ligands to confirm their role in binding or activation.

  • Structure-activity relationship studies: Testing structurally related compounds to identify key molecular features required for receptor activation, as demonstrated for OR17-40 where only helional and the structurally related heliotroplyacetone activated the receptor .

  • Fingerprint interaction analysis: Identifying specific molecular interactions between the receptor and its ligands .

For Olfr187, one would likely find that the binding pocket shares the characteristic features of other ORs: smaller size but greater flexibility compared to non-olfactory GPCRs, potentially explaining the typically lower potency of OR agonists .

How can Olfr187 be studied in the context of non-olfactory tissues?

To investigate Olfr187 in non-olfactory contexts:

  • Tissue expression profiling: Using RT-PCR, RNA-seq, or in situ hybridization to detect Olfr187 expression in various tissues.

  • Animal models: Creating knockout or overexpression models to study physiological consequences, similar to studies examining ORs in kidney fibrosis .

  • Cell-type specific reporters: Generating reporter mice with fluorescent proteins under the control of the Olfr187 promoter.

  • Disease model correlation: Analyzing changes in Olfr187 expression during disease progression, as performed for other ORs in renal disorders using time-course microarray analysis .

  • Primary cell culture: Isolating and culturing cells from tissues of interest to study Olfr187 function ex vivo.

The systems biology approach used to identify OR involvement in kidney fibrosis provides a template for studying Olfr187 in diverse physiological and pathological contexts .

What are the current approaches to studying structure-function relationships in Olfr187?

Structure-function relationship studies employ several techniques:

  • Computational modeling: Creating homology models based on related GPCRs with known structures and refining them through molecular dynamics simulations.

  • Chimeric receptors: Creating fusion proteins between Olfr187 and related ORs to identify regions responsible for specific ligand recognition patterns.

  • Systematic mutagenesis: Alanine scanning or directed mutagenesis of key residues, particularly focusing on transmembrane domains that form the binding pocket.

  • Ligand docking: Virtual placement of potential ligands in the modeled binding pocket to identify key interaction points.

  • Biophysical methods: Techniques like HDX-MS (hydrogen-deuterium exchange mass spectrometry) to identify regions that undergo conformational changes upon ligand binding.

The finding that OR binding pockets are smaller but more flexible than typical GPCRs suggests specific structural adaptations for detecting diverse odorants with lower affinity interactions .

How can the M2OR database be utilized to advance Olfr187 research?

The M2OR database offers valuable resources for OR researchers:

  • Comparative ligand analysis: The database contains information on 768 compounds tested against multiple ORs, allowing researchers to identify potential Olfr187 ligands based on structural similarities to compounds active at related receptors .

  • Assay methodology guidance: With 75,050 different experiments represented, researchers can find optimal assay conditions and methodologies for testing Olfr187 .

  • Negative data utilization: The database includes 48,295 non-responsive pairs, valuable for understanding what chemical structures are unlikely to activate Olfr187 .

  • Binding pattern recognition: Analysis of agonist patterns (representing 6% of the database entries) could inform computational models for predicting Olfr187 ligands .

  • Cross-reference with therapeutic compounds: Some OR agonists have therapeutic potential, such as the Ibuprofen degradation product p-isobutylphenol which activates Olfr73 .

The database represents the largest collection of OR bioassay data available and provides a foundation for developing hypotheses about Olfr187 ligand interactions .

What are common challenges in Olfr187 expression and how can they be addressed?

Common challenges and solutions include:

  • Low surface expression:

    • Solution: Co-express with RTP1, RTP2, and REEP1 accessory proteins

    • Add N-terminal rho tag sequences to enhance trafficking

    • Optimize temperature, often reducing to 30-32°C after transfection

  • Poor functionality:

    • Solution: Ensure proper coupling to G-proteins by co-expressing appropriate Gα subunits

    • Verify receptor conformation through binding assays with known ligands

    • Consider different cell lines; Hana3A cells have shown superior results for OR expression

  • Protein instability:

    • Solution: Store in Tris-based buffer with 50% glycerol

    • Avoid repeated freeze-thaw cycles by working with aliquots

    • For extended storage, conserve at -20°C or -80°C

  • Low signal in functional assays:

    • Solution: Optimize signal detection using more sensitive methods

    • Consider signal amplification strategies (e.g., chimeric G-proteins)

    • Verify expression levels using fluorescent tags before functional testing

  • Difficulty identifying ligands:

    • Solution: Use computational approaches to predict potential ligands

    • Screen mixtures first, then individual components

    • Consider structurally diverse compound libraries

How can I validate that my recombinant Olfr187 is properly folded and functional?

Validation of proper folding and functionality requires multiple approaches:

  • Surface expression verification:

    • Using N-terminal tagging and cell surface labeling techniques

    • Flow cytometry analysis of surface expression

    • Confocal microscopy to confirm membrane localization

  • Ligand binding assays:

    • Binding of known OR ligands if available

    • Competition binding assays

    • Biophysical methods to measure direct ligand interaction

  • Functional response measurements:

    • Calcium imaging to detect odorant-induced Ca²⁺ increases

    • cAMP reporter assays (SEAP, GloSensor)

    • Luciferase-based reporter systems

  • Control comparisons:

    • Include positive controls (other well-characterized ORs)

    • Test with odorant mixtures like Henkel 100

    • Include mock-transfected cells as negative controls

  • Dose-response relationships:

    • Establish concentration-dependent activation curves

    • Compare potency and efficacy parameters to literature values for related ORs

What are best practices for data analysis when characterizing novel ligands for Olfr187?

Best practices for data analysis include:

  • Normalization strategies:

    • Normalize responses to a reference agonist

    • Account for baseline drift and non-specific effects

    • Consider Z-factor calculations to assess assay quality

  • Statistical approaches:

    • Use appropriate statistical tests (t-tests, ANOVA)

    • Account for multiple comparisons in large screening datasets

    • Determine EC₅₀/IC₅₀ values with 95% confidence intervals

  • Structure-activity relationship analysis:

    • Group compounds by chemical scaffolds

    • Identify pharmacophore features important for activity

    • Create quantitative structure-activity relationship (QSAR) models

  • Comparison with databases:

    • Cross-reference results with M2OR database entries

    • Compare with related ORs and their known ligands

    • Identify unique vs. shared recognition patterns

  • Publication standards:

    • Report both active and inactive compounds

    • Include full dose-response curves

    • Provide detailed methodological information for reproducibility

By systematically analyzing activation patterns across structurally related compounds, researchers can identify the molecular determinants of ligand recognition and develop predictive models for Olfr187 activity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.