Recombinant Mouse Olfactory receptor 18 (Olfr18)

Shipped with Ice Packs
In Stock

Description

Production and Expression Systems

Recombinant Olfr18 is produced using two primary platforms:

A. E. coli Expression

  • Advantages: Cost-effective, high yield (~90% purity) .

  • Form: Lyophilized powder with His tag .

Mammalian Cell Systems (e.g., HEK293)

  • Advantages: Proper post-translational modifications .

  • Form: Liquid or lyophilized powder with His-Fc-Avi tags .

Functional Roles

  • G-Protein Coupled Receptor Activity: Initiates cAMP signaling upon odorant binding .

  • Olfactory Transduction: Participates in odor discrimination via combinatorial coding .

Pathway Involvement

PathwayAssociated Proteins
Olfactory TransductionGNB1, OR2L2, ADRBK2, and 241 other subfamilies

Key Interactions

  • Directly interacts with n-aliphatic odorants and aromatic aldehydes .

  • Activated by acetophenone and structurally related compounds .

Research Applications and Findings

Odorant Screening

  • In Vivo Activation: Phosphorylated ribosome immunoprecipitation (pS6-IP) identified Olfr18 as responsive to acetophenone in awake mice .

  • Ligand Specificity: Shares residues with acetophenone-sensitive receptors, enabling predictive modeling of receptor activation .

Comparative Studies

  • Human vs. Mouse: Olfr18 belongs to one of 150 subfamilies shared between species, but mouse subfamilies are generally larger, suggesting enhanced odor discrimination .

Limitations and Future Directions

  • Functional Redundancy: Overlaps with other subfamilies may complicate ligand-receptor mapping .

  • Structural Studies: Lack of crystallographic data limits mechanistic insights.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we currently have in stock. However, if you have specific requirements for the format, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
Olfr18; Mor145-1; Olfactory receptor 18; Olfactory receptor 145-1; Olfactory receptor TPCR34
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-331
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Olfr18
Target Protein Sequence
MMDRYSFIMHQHRDDTVWCPSKIEEQNITRISEFHLMGLSDDLQLQPILFGLFLSMYLVT LLGNLLIILTVSSDSHLHSPMYFFLSNLSLADVSFTSTTLPKMIVDIQTHNRAISYSGCL TQMSFFMLFGCLDSLLLTAMAYDRFVAICHPLHYQFIMNPRLCGLLVFLSVLISLFVSQL HNSVVLQLTYFKSVDISHFFCDPSQLLNLACSDTFTNNIVMYFVGAISGFLPISGIFFSY YKIVSSILRMPSPGGKYKAFSTCGSHLSVVCLFYGTGLGVYLSSAVSLSPRKGAVASIVY TVVTPMLNPFIYSLRNQDIKRAMWRLLRKTV
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Advanced Research Questions

  • What are the optimal conditions for functional expression of Olfr18 in heterologous systems?

Based on studies with other olfactory receptors like mOR256-17, the following optimized conditions may be applicable to Olfr18 expression:

ParameterRecommended ConditionRationale
Host SystemMammalian cells (HEK293T)Better folding and trafficking of GPCRs
Temperature25-30°CSlower expression promotes proper folding
Expression Time24-48 hoursBalances yield and proper folding
Inducer ConcentrationLow (e.g., 0.1 mM IPTG for inducible systems)Prevents aggregation and toxicity
Media Composition5 g/L yeast extract, 5 g/L tryptone, 10 g/L NaCl, 1 g/L glucoseOptimized for membrane protein expression
AdditivesReceptor transport proteins (RTPs), Ric8bEnhances receptor trafficking and function

It's important to note that these conditions should be further optimized for Olfr18 specifically through factorial design experiments, as described in similar studies .

  • What methodologies are most effective for detecting and quantifying recombinant Olfr18 expression?

Multiple complementary approaches can be employed to detect and quantify recombinant Olfr18 expression:

  • Fluorescent Protein Fusion:

    • C-terminal fusion with GFP allows quantification of total protein expression

    • Enables live-cell imaging and localization studies

    • Can be quantified by fluorescence microscopy or flow cytometry

  • Immunological Detection:

    • Western blotting using anti-His antibodies (for His-tagged proteins)

    • ELISA for quantitative measurement

    • Immunocytochemistry for localization studies

  • Functional Assays:

    • cAMP accumulation assays using FRET-based sensors

    • Calcium imaging with fluorescent calcium indicators

    • Electrophysiological recordings (patch-clamp)

  • Surface Expression Quantification:

    • N-terminal epitope tagging with sequences recognized by antibodies

    • Cell-surface biotinylation followed by pulldown

    • Flow cytometry of non-permeabilized cells

A dual-color labeling approach has proven particularly effective for olfactory receptors, combining C-terminal GFP fusion to quantify total expression with N-terminal epitope tagging to selectively visualize and quantify receptors at the plasma membrane using flow cytometry .

  • How can researchers identify specific ligands for Olfr18?

Identifying specific ligands for Olfr18 requires systematic screening approaches:

  • High-throughput screening methods:

    • Cell-based functional assays using calcium imaging

    • FLIPR (Fluorescent Imaging Plate Reader) technology

    • Automated patch-clamp recordings

  • Odorant library screening:
    A systematic approach should include:

    • Initial screening with structurally diverse odorants

    • Secondary screening with structurally related compounds

    • Dose-response analysis to determine EC₅₀ values

  • In vivo validation:

    • Calcium imaging in acutely dissociated OSNs

    • Electrophysiological recordings from genetically labeled neurons

    • Behavioral assays in mouse models

Studies on other olfactory receptors like mOR256-17 have successfully identified ligands through screening large odorant compound libraries . The identified ligands typically exhibit structural similarity, allowing the development of a structure-activity relationship. Similar approaches could be applied to Olfr18, potentially revealing its ligand specificity profile.

For validation, comparison of response profiles between heterologously expressed Olfr18 and native Olfr18+ OSNs is crucial to confirm physiological relevance of identified ligands .

  • What experimental designs are most appropriate for studying Olfr18 signaling dynamics?

Effective experimental designs for studying Olfr18 signaling dynamics include:

  • Time-resolved signaling measurements:

    • FRET-based sensors for real-time cAMP or Ca²⁺ measurements

    • Bioluminescence resonance energy transfer (BRET) for monitoring protein-protein interactions

    • Electrophysiological recordings with fast solution exchange systems

  • Dose-response relationship characterization:

    • Systematic testing of ligand concentrations (typically 10⁻⁹ to 10⁻³ M)

    • Analysis of EC₅₀, Eₘₐₓ, and Hill coefficient

    • Comparison between different ligands to establish structure-activity relationships

  • Signaling pathway dissection:

    • Pharmacological inhibitors of specific pathway components

    • siRNA knockdown of pathway proteins

    • CRISPR/Cas9-mediated gene editing of pathway components

  • Factorial experimental design approaches:
    For optimizing multiple parameters simultaneously, as described in general recombinant protein expression studies:

    • Identification of key variables (temperature, induction time, etc.)

    • Statistical analysis to determine significant effects and interactions

    • Validation of optimized conditions in replicate experiments

When designing these experiments, researchers should incorporate appropriate controls, including mock-transfected cells, cells expressing non-responsive ORs, and positive controls with known ligand-receptor pairs .

  • How does Olfr18 expression compare with other olfactory receptors in terms of challenges and opportunities?

Comparing Olfr18 with other olfactory receptors reveals several patterns:

AspectOlfr18Other ORs (e.g., mOR256-17, SR1)Research Implications
Expression EfficiencyChallenges similar to other ORsDifficult to express in high yieldsSpecialized expression strategies required
Ligand SpecificityNot fully characterizedSome ORs (e.g., MOR256-17) show broad responsivenessOpportunity to define Olfr18's response spectrum
Structural InformationLimitedLimited for most ORsPotential for pioneering structural studies
Genetic ModificationPossible through gene targetingSuccessfully applied to several ORsOpportunity for in vivo functional studies
Evolutionary ConservationPart of rapidly evolving gene familyVariable across speciesInsights into species-specific olfactory adaptations

While many olfactory receptors face similar expression challenges, some like MOR256-17 have been successfully expressed at levels of 10⁶ receptors per cell in transiently transfected mammalian cells . Such success stories provide methodological frameworks that could be adapted for Olfr18.

The extremely broad odorant response profile of some ORs like MOR256-17 and SR1 raises questions about whether Olfr18 exhibits similar breadth or is more narrowly tuned. This represents an opportunity for comparative functional characterization.

  • What are the current approaches for studying the structural biology of olfactory receptors like Olfr18?

Structural biology of olfactory receptors remains challenging, but several approaches show promise:

  • Computational modeling:

    • Homology modeling based on crystal structures of other GPCRs

    • Molecular dynamics simulations to study ligand binding and conformational changes

    • In silico screening for potential ligands

  • Stabilization strategies for experimental structural determination:

    • Fusion with crystallization chaperones (e.g., T4 lysozyme)

    • Thermostabilizing mutations

    • Nanobody-assisted stabilization of specific conformations

  • Advanced structural biology techniques:

    • X-ray crystallography of stabilized receptors

    • Cryo-electron microscopy (cryo-EM)

    • Solid-state NMR spectroscopy

    • Site-directed spin labeling coupled with EPR spectroscopy

  • Fragment-based approaches:

    • Studying isolated domains of the receptor

    • Synthesizing peptides corresponding to transmembrane domains

    • Reconstitution of purified receptors in nanodiscs or lipid cubic phase

The expression system developed for mOR256-17, yielding 10⁶ ORs per cell in transiently transfected mammalian cells , represents a significant step toward obtaining sufficient protein for structural studies. Similar approaches could be applied to Olfr18.

Recent advances in cryo-EM and computational methods have revolutionized GPCR structural biology, potentially opening new avenues for olfactory receptor structure determination, including Olfr18 .

  • How can genetic engineering approaches be used to study Olfr18 function in vivo?

Several genetic engineering approaches can be employed to study Olfr18 function in vivo:

  • Gene targeting strategies:

    • Replacement of the endogenous Olfr18 coding sequence with reporter genes (e.g., GFP, LacZ)

    • Conditional knockout using Cre-loxP system

    • CRISPR/Cas9-mediated genome editing for precise modifications

  • Reporter gene systems:

    • IRES-GFP/tauGFP constructs for labeling Olfr18-expressing neurons

    • Cre-dependent reporter expression for lineage tracing

    • Activity-dependent reporters to monitor neuronal activation

  • Functional imaging platforms:

    • MyrPalm-GCaMP6f fusion for membrane-localized calcium indicators

    • Two-photon imaging of OSN responses in the intact epithelium

    • In vivo imaging of glomerular activity in the olfactory bulb

  • Genetic rescue experiments:

    • Re-expression of Olfr18 in OR-deleted backgrounds

    • Expression of mutant Olfr18 variants to identify functional domains

    • Cross-species OR expression to study evolutionary aspects

Researchers have successfully applied these approaches to other ORs, generating mouse lines with labeled OSNs expressing specific receptors . These models allow for:

  • Visualization of the spatial distribution of Olfr18-expressing neurons

  • Tracking of axonal projections to glomeruli in the olfactory bulb

  • Functional characterization of Olfr18-expressing neurons in their native environment

  • Assessment of behavioral consequences of Olfr18 dysfunction

  • What role does Olfr18 play in non-olfactory tissues, and how can this be investigated?

Recent research has revealed that olfactory receptors, including several from the same family as Olfr18, are expressed in non-olfactory tissues where they may serve diverse functions:

  • Potential non-olfactory roles:

    • Regulation of cell proliferation and migration

    • Modulation of metabolic processes

    • Involvement in tissue regeneration

    • Participation in immune responses

  • Methods to investigate tissue expression:

    • RT-qPCR analysis across multiple tissues

    • RNA-seq data mining from tissue-specific datasets

    • Single-cell RNA sequencing to identify cell types expressing Olfr18

    • In situ hybridization to localize expression

  • Functional characterization approaches:

    • Tissue-specific genetic knockdown or knockout

    • Time-course expression analysis during physiological processes (e.g., development, regeneration)

    • Correlation with pathological conditions

A study of olfactory receptors in kidney fibrosis revealed significant changes in the expression patterns of several ORs, including upregulation over time compared to control conditions . Similar approaches could be applied to investigate potential roles of Olfr18 in non-olfactory tissues:

Experimental ApproachApplication to Olfr18Expected Outcome
Time-course expression analysisMonitor Olfr18 expression during disease progressionIdentify temporal patterns of regulation
Two-way ANOVA analysisCompare expression patterns between disease and control groupsDetermine significance of expression changes
Pathway analysisIdentify signaling pathways associated with Olfr18 expressionReveal potential functional roles

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.