Recombinant Mouse Olfactory receptor 19 (Olfr19)

Shipped with Ice Packs
In Stock

Description

Role in Olfactory Signaling

Olfr19 is part of the olfactory receptor superfamily, which detects volatile odorants and activates downstream signaling via G proteins (e.g., Gα<sub>olf</sub>, β/γ subunits) . Key functional partners identified via the STRING database include:

  • Gnal (Gα<sub>olf</sub>): Mediates cAMP signaling .

  • Arrb1/2 (β-arrestins): Regulate receptor desensitization .

  • Grk2/3 (GPCR kinases): Phosphorylate activated receptors .

Ligand Specificity

While Olfr19 remains an orphan receptor (no confirmed ligands), studies on related receptors (e.g., Olfr558, Olfr90) suggest potential activation by microbial metabolites or fungal-derived compounds . Structural modeling predicts ligand-binding pockets in transmembrane helices 3–7, typical of odorant-sensing GPCRs .

Experimental Use Cases

  • Ligand Screening: Employed in luciferase-based assays to identify activators/inhibitors via cAMP response element (CRE) reporters .

  • Structural Studies: Used for X-ray crystallography or cryo-EM to resolve receptor-ligand interactions .

  • Antibody Production: Serves as an immunogen due to high purity and full-length conformation .

Technical Considerations

  • Reconstitution: Requires centrifugation before solubilization to avoid aggregation .

  • Stability: Repeated freeze-thaw cycles degrade activity; working aliquots stored at 4°C retain function for ≤1 week .

Comparative Analysis with Other Olfactory Receptors

FeatureOlfr19Other Olfrs (e.g., Olfr558)
Ligand StatusOrphanKnown ligands (e.g., carboxylic acids)
Tissue DistributionPredominantly olfactory epithelium Kidney, liver, lung
Signaling PartnersGα<sub>olf</sub>, β-arrestins Similar GPCR machinery

Challenges and Future Directions

  • Deorphanization: High-throughput screening (e.g., pS6-IP or calcium imaging) is needed to identify ligands .

  • In Vivo Validation: Spatial transcriptomics could map Olfr19 expression zones in the olfactory mucosa .

  • Evolutionary Conservation: Human orthologs (e.g., OR51E1) may share functional roles, warranting cross-species studies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes, and we will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimates, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution at -20°C/-80°C. Our standard final glycerol concentration is 50% and can serve as a reference point for your own preparations.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have specific tag type preferences, please inform us, and we will prioritize developing the specified tag.
Synonyms
Olfr19; Mor140-1; Olfactory receptor 19; Odorant receptor M12; Olfactory receptor 140-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-309
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Olfr19
Target Protein Sequence
MELKNDTQISKFILLGISEDPLWQPFLFGLFLFMYLVTLLGNLLIIIATITDSHLHTPMY FFLSNLSFADICFTSASIPKMLVNIQTKNKVITYEGCISQVFFFILFGVLDNFLLAVMAY DRYVAICHPLHYMVIMNCRLCGFLVLGSWVTTALNSLLQSSMALRLSFCTDLKIPHFVCE LNQLVLLACNDTFPNDMVMYFAAILLGGGPLAGILYSYSKIVSSIRAISSSQGKYKAFST CASHLSVVSLFYSTLLGVYLSSSFTQNSHSTARASVMYSVVTPMLNPFIYSLRNKDLMGA LRRLLRRKS
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for recombinant Olfr19 expression?

Mammalian cell lines, particularly HEK293 cells, are currently the gold standard for olfactory receptor expression. Based on successful approaches with other mouse olfactory receptors, transiently transfected mammalian cells can yield approximately 10^6 receptors per cell . For Olfr19 expression, consider the following methodology:

  • Transfect cells with vectors containing Olfr19 coding sequence with appropriate trafficking signals

  • Co-express accessory proteins that enhance surface expression, such as olfactory-specific G protein α (GNAL/Gαolf) and Ric-8B (a chaperone of Gα protein)

  • Include receptor transporting proteins (RTPs) which have been shown to improve trafficking of ORs to the cell membrane in heterologous systems

It's worth noting that recent research has identified common structural features of ORs that can be expressed on the cell surface independent of RTPs, which might be applicable to Olfr19 expression optimization .

How can I quantify and optimize Olfr19 expression levels?

Dual-color labeling approaches provide robust quantification methods:

  • Fusion proteins: Attach a fluorescent reporter (e.g., GFP) to the C-terminus of Olfr19 to monitor total cellular expression

  • N-terminal labeling: Add a small peptide tag (12-amino acid) to the N-terminus for selective visualization of membrane-localized receptors using cell-impermeable fluorescent probes

  • Flow cytometry analysis: Quantify the proportion of surface-expressed versus total cellular receptor

This dual-labeling strategy allows for simultaneous assessment of total receptor biosynthesis and successful membrane targeting, essential metrics for optimizing expression protocols.

What are the primary challenges in achieving functional Olfr19 expression?

Olfactory receptors, including Olfr19, face several critical challenges in heterologous expression systems:

  • Protein aggregation and retention in the endoplasmic reticulum (ER)

  • Improper folding leading to degradation

  • Poor coupling to non-native G proteins in heterologous systems

  • Variable glycosylation patterns affecting trafficking

To address these challenges, consider co-expressing Olfr19 with olfactory-specific signaling components such as Golf and Ric-8B, which enhance receptor coupling to downstream signaling pathways . Additionally, growing cells at lower temperatures (30-32°C) and adding chemical chaperones may improve folding efficiency and membrane targeting.

What methods are most effective for screening potential Olfr19 ligands?

High-throughput screening approaches for Olfr19 should incorporate:

  • Cell-based assays measuring second messenger production (cAMP)

  • Real-time calcium imaging for immediate response detection

  • Microwell array systems for parallel screening of multiple compounds

Based on successful approaches with other olfactory receptors, a recommended method involves:

  • Creating a cell array with Olfr19-expressing cells in microwells (0.5mm square, approximately 400-500 cells per well)

  • Loading cells with calcium-sensitive dyes

  • Using an automated perfusion system to deliver potential ligands

  • Monitoring fluorescence changes in real-time with video microscopy

This approach allows for rapid assessment of multiple compounds while avoiding prolonged exposure to potentially cytotoxic or unstable odorants.

Why is real-time measurement important for characterizing Olfr19 responses?

Real-time measurement is critical for several reasons:

  • Many odorants are chemically unstable and degrade during extended exposure periods

  • Olfactory receptors exhibit rapid adaptation, similar to the natural olfactory system

  • Concentration-dependent responses may show complex kinetics that are missed in endpoint measurements

  • Some odorants can act as inverse agonists depending on concentration

Instead of endpoint cAMP measurements after prolonged stimulation (30 minutes to several days), real-time calcium imaging more accurately reflects the physiological response patterns of olfactory sensory neurons. This approach is particularly important when studying receptor adaptation, which occurs within minutes of stimulation .

How can I determine the EC50 and sensitivity range for Olfr19?

To determine the EC50 and sensitivity profile for Olfr19:

  • Perform concentration-response experiments using a flow dilution olfactometer to deliver precise odorant concentrations

  • Measure responses at multiple concentrations (typically 10^-9 M to 10^-4 M)

  • Plot response amplitudes against concentration and fit to a Hill function:

    R = Rmax × C^n/(EC50^n + C^n)

    Where R is response amplitude, C is odor concentration, EC50 is concentration at half-maximal response, and n is the Hill coefficient

  • Compare EC50 values between experiments using appropriate statistical tests (e.g., sum-of-squares F test)

For reference, studies with trace amine-associated receptors have successfully used this approach to determine sensitivity thresholds, with EC50 values typically ranging from 10^-9 M to 10^-5 M depending on the receptor-ligand pair .

How do I account for variability in Olfr19 responses between experiments?

Addressing variability requires systematic controls:

  • Include positive control receptors with known ligands in each experiment

  • Normalize responses to internal standards (receptor with established dose-response curve)

  • Use multiple biological replicates (minimum n=3) for each condition

  • Account for cell-to-cell variability by analyzing population-level responses

Technical considerations include maintaining consistent:

  • Cell passage numbers

  • Transfection efficiency (monitored via reporter expression)

  • Recording conditions (temperature, buffer composition)

  • Ligand preparation and storage protocols

How should mixture interactions at Olfr19 be analyzed and interpreted?

Analysis of odor mixture effects requires special considerations:

  • Test individual components separately before examining mixtures

  • Design experiments to detect:

    • Additive effects (linear relationship between individual and mixture responses)

    • Synergistic effects (enhanced response compared to individual components)

    • Antagonistic effects (reduced response compared to individual components)

    • Inverse agonism (inhibition of basal activity)

Recent research indicates that mixture interactions at mammalian olfactory receptors are often non-linear due to:

  • Competitive binding between odorants

  • Allosteric effects where one odorant modifies the receptor's response to another

  • Concentration-dependent shifts between agonism and antagonism

For rigorous mixture analysis, mathematical modeling approaches such as competitive binding models or allosteric modulation frameworks can be applied to the experimental data.

What approaches can distinguish between specific and non-specific responses in Olfr19 studies?

To differentiate specific from non-specific responses:

  • Include receptor-negative control cells in all experiments

  • Use structurally similar compounds as specificity controls

  • Perform concentration-response studies (non-specific effects often lack concentration-dependence)

  • Test known antagonists to block putative specific responses

  • Create point mutations in key binding residues to verify ligand-receptor specificity

For data analysis, calculate signal-to-noise ratios and establish clear threshold criteria for positive responses (typically >3-5 standard deviations above baseline fluctuations).

How can I use CRISPR-Cas9 to study Olfr19 function in vivo?

CRISPR-Cas9 genome editing offers powerful approaches for Olfr19 research:

  • Generation of Olfr19 knockout mice:

    • Design guide RNAs targeting exonic regions of Olfr19

    • Validate knockouts by sequencing and RT-PCR

    • Assess behavioral phenotypes in odor detection assays

  • Fluorescent tagging of endogenous Olfr19:

    • Create knock-in constructs with fluorescent reporters

    • Enable visualization of native expression patterns

    • Track receptor trafficking in olfactory sensory neurons

  • Single-base editing for structure-function studies:

    • Introduce specific point mutations to test binding site hypotheses

    • Create human polymorphism equivalents to study variations

When assessing behavioral impacts, consider using established paradigms such as the DREAM assay (Differential RNA Expression by Activated Murine Odorant Receptors) to correlate receptor activation with changes in gene expression .

How does Olfr19 activation relate to behavioral responses in mice?

While specific data on Olfr19's behavioral effects are not detailed in the provided literature, research with other olfactory receptors suggests the following methodology to establish such connections:

  • Generate receptor-specific knockout or overexpression models

  • Test behavioral responses using:

    • Go/No-Go odor detection tasks to determine detection thresholds

    • Innate attraction/aversion assays to assess valence

    • Habituation/dishabituation tests to measure discrimination

Recent studies have demonstrated that individual olfactory receptors can substantially influence behavioral thresholds. For example, research on trace amine-associated receptors (TAARs) showed that odor detection thresholds are determined by the most sensitive receptor in the repertoire . Similarly, studies with Olfr1019 revealed that knockout of this single receptor reduced but did not eliminate immobility responses to its ligand (TMT), indicating partial redundancy in the system .

What approaches best characterize structure-function relationships in Olfr19?

To investigate structure-function relationships:

  • Computational modeling:

    • Generate homology models based on known GPCR structures

    • Perform molecular docking simulations with putative ligands

    • Identify key binding pocket residues

  • Experimental validation:

    • Create point mutations of predicted binding site residues

    • Test receptor function using calcium imaging or cAMP assays

    • Perform chimeric receptor studies swapping domains with related ORs

  • Pharmacological profiling:

    • Test structurally related compounds to build structure-activity relationships

    • Investigate allosteric binding sites using specialized pharmacological tools

    • Examine the effects of receptor sensitization or desensitization protocols

What are the most common pitfalls in Olfr19 recombinant expression?

Common technical issues and solutions include:

ChallengePotential CausesSolutions
Poor membrane localizationER retention, protein misfoldingCo-express with RTPs, Ric-8B, and GNAL/Gαolf
Low response magnitudeInsufficient coupling to signaling cascadeUse optimized detection systems (e.g., GloSensor for cAMP, genetically encoded calcium indicators)
Variable expression levelsPromoter silencing, toxicityAdjust transfection conditions, use inducible expression systems
Ligand instabilityOxidation, hydrolysis, adsorption to plasticsPrepare fresh dilutions, use appropriate solvents, minimize exposure time
Non-specific responsesCell stress, solvent effectsInclude vehicle controls, use receptor-negative cells as references

How can I optimize signal detection for low-sensitivity olfactory receptors like Olfr19?

For receptors with low sensitivity or weak coupling:

  • Signal amplification strategies:

    • Use sensitive second messenger detection systems (e.g., GloSensor technology for cAMP)

    • Implement signal integration over longer time periods for calcium imaging

    • Employ bioluminescence resonance energy transfer (BRET) based approaches

  • Expression optimization:

    • Create stable cell lines with controlled receptor density

    • Use stronger promoters or optimize codon usage for improved expression

    • Consider using specialized cell backgrounds (e.g., Hana3A cells engineered for OR expression)

  • Recording conditions:

    • Minimize background fluorescence through careful dye selection

    • Reduce assay temperature to slow receptor internalization

    • Include phosphodiesterase inhibitors to enhance cAMP accumulation

How does Olfr19 function compare to other characterized mouse olfactory receptors?

Comparative analysis requires systematic approaches:

  • Deorphanization studies:

    • Screen the same odorant library against multiple receptors

    • Compare EC50 values, efficacy, and response kinetics

    • Identify shared versus unique ligands

  • Phylogenetic analysis:

    • Examine sequence homology with functionally characterized ORs

    • Correlate sequence similarities with functional properties

    • Investigate evolutionary relationships within receptor subfamilies

  • Expression pattern comparison:

    • Use in situ hybridization or RNAseq to map expression zones

    • Compare with other receptors in the same subfamily

    • Correlate expression patterns with functional specialization

Current research suggests substantial diversity in ligand specificity and sensitivity among mouse olfactory receptors. For example, studies with mOR256-17 revealed specific agonist profiles through large odorant library screening , while research on TAARs demonstrated high sensitivity to specific amines at nanomolar concentrations .

What methods best translate findings from mouse Olfr19 to human olfactory receptor research?

Translational approaches should include:

  • Identification of human orthologs:

    • Perform phylogenetic analysis to identify closest human counterparts

    • Compare binding pocket residues between species

    • Test conserved ligands across species barriers

  • Comparative functional studies:

    • Express both receptors in identical systems

    • Test identical ligand panels under standardized conditions

    • Analyze differences in specificity, sensitivity, and signaling dynamics

  • Polymorphism analysis:

    • Examine functional effects of SNPs in human orthologs

    • Correlate with perceptual differences in human subjects

    • Consider population-specific variations

Recent human olfactory receptor research has demonstrated significant impacts of SNPs on receptor function, with variations sometimes altering odor perception . These approaches can help translate findings from mouse Olfr19 to human olfactory biology and potential applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.