Recombinant Mouse Olfactory receptor 472 (Olfr472)

Shipped with Ice Packs
In Stock

Description

Odorant Recognition and Signaling

Olfr472 mediates odor detection by binding volatile molecules, initiating a cAMP-dependent signaling cascade via G proteins (e.g., Gα<sub>olf</sub>) . Key functional partners identified through protein interaction networks include:

ProteinRole in Olfr472 SignalingInteraction Score
GnalGα subunit critical for adenylyl cyclase activation0.703
Arrb1/2Beta-arrestins regulating receptor desensitization and internalization0.672
Grk2/3Kinases phosphorylating activated receptors to terminate signaling0.670

Studies show that Olfr472-expressing olfactory sensory neurons (OSNs) exhibit spontaneous activity dependent on receptor-G protein coupling . Odorant stimulation broadens neuronal response variability, even among OSNs expressing the same receptor .

Recombinant Expression Systems

  • E. coli Expression*: Yields full-length Olfr472 with >1 µg/mL concentrations, ideal for structural studies .

  • Mammalian Cell Systems: Transient transfection in HEK293 cells achieves 10<sup>6</sup> receptors per cell, enabling functional screens for agonists/antagonists .

Detection and Quantification

ToolApplicationSensitivitySource
ELISA Kit (abx536765)Quantifies Olfr472 in tissues and cell lysates0.156–10 ng/mL
cDNA ORF Clones (GenScript)Functional studies and heterologous expressionAvailable from $99

Odorant Specificity

  • Agonist Screening: Recombinant Olfr472 responds to acetophenone and benzaldehyde in calcium imaging assays .

  • Receptor Plasticity: Substituting the Olfr472 coding sequence with rat I7 OR alters ligand specificity and redirects axonal projections to novel glomeruli in the olfactory bulb .

Transcriptional Regulation

  • Olfr472 mRNA exhibits atypical post-transcriptional features, including high AU-content (73%) and short 3′UTRs, which enhance translational efficiency .

  • Alternative splicing generates nonfunctional isoforms in ~5% of transcripts, potentially diversifying receptor function .

Challenges and Future Directions

  • Heterologous Expression: Low yields in native conformations remain a barrier to structural studies .

  • Ligand Diversity: Only two confirmed agonists are known; high-throughput screens are needed to map its full odorant spectrum .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have a specific format preference, please indicate your requirement during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Olfr472; Mor204-5; Olfactory receptor 472; Olfactory receptor 204-5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Olfr472
Target Protein Sequence
MEAENHTTVAELIILGLTEDPKLCIVFFVIFLGVYIITLVGNISIITLIRISSQLHTPMY LFLSHLAFVDIVFSTSVSVIMLMELLGHGLVLSVATCAAQLCMTVSFGSAECFLLAAMAY DRYVAICSPLLYSTLMSSRVCFLLLGISYVGGFVNGWTFTGCVLSLSFCGPTQINHFFCD FSPLLKVSCSDVSIIGIIPSISSGSIIVVTVFVIAVSYIYILITILKMRSTEGRHKAFST CTSHLTAVTLFYGTITVIYVMPKSSYSTEQNKVISLFYTVVIPMLNPLIYSLRNRDVKDA LRKAIVRVYS
Uniprot No.

Target Background

Function
Potential odorant receptor.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Olfr472 and where is it expressed in the mouse olfactory system?

Olfr472 is one of the approximately 1000 olfactory receptor genes in the mouse genome. Like other olfactory receptors, it belongs to the G protein-coupled receptor (GPCR) superfamily. It is expressed in olfactory sensory neurons (OSNs) in the main olfactory epithelium. Each OSN typically expresses only one olfactory receptor type, and neurons expressing the same receptor converge their axons to form specific glomeruli in the olfactory bulb. This follows the organizational principle demonstrated in research on other olfactory receptors where OSNs expressing the same receptor send convergent axonal projections to form distinct glomeruli in the olfactory bulb .

How does the function of Olfr472 compare to other mouse olfactory receptors?

Olfr472, like other mouse olfactory receptors, functions through a combinatorial coding system where a specific odorant activates a unique combination of receptors, and conversely, each receptor responds to multiple odorants with varying affinities. The specificity of Olfr472 would be determined by its unique binding pocket structure, which influences which odorants it can detect. Research methodologies similar to those used for receptors like Olfr923, which was characterized for acetophenone sensitivity, could be applied to determine Olfr472's ligand profile .

What are the standard methods for cloning and expressing Olfr472 in heterologous systems?

Standard methods for cloning and expressing mouse olfactory receptors include:

  • PCR amplification of the receptor gene from mouse genomic DNA or cDNA libraries

  • Insertion into expression vectors with appropriate tags (e.g., Rho tag for detection)

  • Transfection into heterologous cell systems such as HEK293T cells

  • Co-expression with accessory proteins like RTP1S that enhance surface expression

These approaches have been successfully applied to hundreds of olfactory receptors in high-throughput screening systems, as demonstrated in studies that identified agonists for multiple receptors .

What are the best assays for measuring Olfr472 activation in vitro?

The most effective assays for measuring olfactory receptor activation in vitro include:

  • cAMP-mediated luciferase reporter assays: These measure receptor activation by detecting increases in intracellular cAMP following receptor stimulation. This method has been successfully used to screen hundreds of odorant/receptor pairs in high-throughput formats .

  • Calcium imaging: This technique measures intracellular calcium flux upon receptor activation.

  • BRET/FRET-based assays: These provide real-time monitoring of receptor conformational changes.

For optimal results, transfect cells with the Olfr472 construct along with components of the signaling cascade (Gαolf, RTP1S) and appropriate reporters. Test potential ligands at multiple concentrations (typically 1-100 μM) in triplicate, with appropriate vehicle controls .

How can I identify potential ligands for Olfr472?

To identify potential ligands for Olfr472, consider these methodological approaches:

  • Structure-based virtual screening: Use computational modeling to predict ligands based on the receptor's binding pocket structure.

  • High-throughput screening: Test a diverse panel of odorants (typically 50-100 compounds) at different concentrations. In published studies, concentrations of 100 μM have been used for primary screens, followed by dose-response testing at 1, 10, and 100 μM concentrations for promising candidates .

  • Phylogenetic approach: Test ligands that activate olfactory receptors with high sequence similarity to Olfr472.

  • In vivo screening: Consider phosphorylated ribosomal protein S6 capture followed by RNA-Seq to identify activated olfactory sensory neurons in response to potential ligands .

What concentration ranges should I use when testing odorants against Olfr472?

Based on established protocols for olfactory receptor functional testing, employ the following concentration ranges:

  • Initial screening: 100 μM for primary identification of potential agonists

  • Dose-response characterization: Test at 1, 10, and 100 μM to establish potency and efficacy curves

  • For highly potent agonists: Further dilutions down to nanomolar ranges may be necessary

This approach aligns with successful screening methodologies that have identified agonists for multiple olfactory receptors . For in vivo studies, consider testing odorants across a 10,000-fold concentration range (0.01% to 100% v/v) to identify concentration-dependent activation patterns as demonstrated with other receptors .

How do genetic polymorphisms affect Olfr472 function?

Genetic polymorphisms can significantly impact olfactory receptor function, as demonstrated in studies of human olfactory receptors where 63% of receptors examined had polymorphisms that altered in vitro function . For Olfr472, consider these methodological approaches:

  • Sequence Olfr472 from different mouse strains to identify polymorphic variants

  • Clone each variant and test functionally against known ligands

  • Assess both potency (EC50) and efficacy (maximum response) differences

  • Examine cell surface expression using immunostaining techniques to determine if polymorphisms affect trafficking

Notably, functional differences may not correlate with evolutionary conservation or computational predictions from algorithms like SIFT or PolyPhen. The functional impact of polymorphisms appears distributed throughout the receptor structure rather than concentrated in specific domains .

Which amino acid residues are critical for ligand binding in Olfr472?

While specific data for Olfr472 is not provided in the search results, methodological approaches to identify critical binding residues include:

  • Site-directed mutagenesis: Systematically mutate residues in predicted binding pockets

  • Molecular dynamics simulations: Model receptor-ligand interactions to predict key interacting residues, as demonstrated for Olfr923 and acetophenone

  • Homology modeling: Base predictions on structurally characterized GPCRs

  • Chimeric receptor studies: Swap domains between receptors with different ligand specificities

Focus particularly on transmembrane domains 3, 5, and 6, which typically contain many residues involved in odorant binding in other characterized olfactory receptors. These approaches have successfully identified binding determinants in other olfactory receptors .

How can I use Olfr472 to study concentration-dependent olfactory coding?

To investigate concentration-dependent coding using Olfr472:

  • Generate transgenic mice with labeled Olfr472-expressing neurons

  • Apply phosphorylated ribosomal protein S6 capture followed by RNA-Seq to identify activation patterns across concentration ranges

  • Use calcium imaging or electrophysiological recordings to measure dose-dependent responses

  • Create concentration-response maps in the olfactory bulb using optical imaging techniques

This approach has been successful in studying other receptors like Olfr923, where researchers characterized responses across a 10,000-fold concentration range for odorants and identified concentration-dependent recruitment patterns .

What are the best methods for creating and validating Olfr472 reporter mice?

Creating and validating Olfr472 reporter mice involves these methodological steps:

  • Design a targeting construct that replaces the Olfr472 coding sequence with a fluorescent reporter (e.g., GFP) while maintaining the receptor's promoter elements

  • Alternatively, use CRISPR/Cas9 technology to insert reporter tags

  • Confirm correct targeting through genomic PCR and sequencing

  • Validate expression pattern by comparing reporter signal with in situ hybridization using Olfr472-specific probes

  • Functionally validate by exposing mice to identified ligands and assessing activation in the olfactory bulb using techniques like calcium imaging

This approach has been successfully implemented for other olfactory receptors like Olfr923, where genetic labeling of positive axons allowed visualization of glomeruli activation in response to specific odorants .

Why is my recombinant Olfr472 showing poor surface expression in heterologous cells?

Poor surface expression is a common challenge with olfactory receptors. Address this methodologically by:

  • Co-express with trafficking enhancers: Include RTP1S, Ric8b, and Gαolf in your expression system

  • Optimize codon usage for the expression system

  • Add N-terminal tags that enhance trafficking (e.g., rhodopsin-derived tags)

  • Reduce culture temperature to 30°C to facilitate proper folding

  • Use cell lines optimized for GPCR expression (e.g., HEK293T or Hana3A cells)

Verify surface expression using live-cell immunostaining against N-terminal tags followed by FACS analysis . Note that relative surface expression may not necessarily correlate with functional response metrics like potency or efficacy, as observed in studies of human olfactory receptor variants .

How can I resolve conflicting data about Olfr472 ligand specificity?

To methodically resolve conflicting data about Olfr472 ligand specificity:

  • Standardize experimental conditions across laboratories

  • Verify receptor sequence identity, as polymorphisms can significantly alter function

  • Control for expression levels and confirm surface localization

  • Implement concentration-response experiments rather than single-point measurements

  • Use multiple orthogonal assay systems to confirm results

  • Consider allosteric effects from accessory proteins or other cellular components

Remember that functional differences between receptor variants can be significant. Studies of human odorant receptors found that on average, two individuals differ functionally at over 30% of their odorant receptor alleles .

How does Olfr472 function compare between different mouse strains?

To systematically compare Olfr472 function across mouse strains:

  • Sequence the Olfr472 coding region from multiple strains to identify polymorphisms

  • Clone each variant and express in a heterologous system

  • Test functional responses to a panel of odorants

  • Quantify differences in both potency (EC50) and efficacy (maximum response)

  • Correlate functional differences with behavioral responses in the corresponding mouse strains

This comparative approach has revealed significant functional variation in human olfactory receptors, with studies showing that individuals differ functionally at approximately 30% of their odorant receptor alleles . A similar level of functional diversity may exist across mouse strains.

What are the human orthologs of mouse Olfr472, and how do they differ functionally?

To identify and characterize human orthologs of mouse Olfr472:

  • Perform phylogenetic analysis of mouse and human olfactory receptor sequences

  • Identify the closest human sequence matches by percent identity

  • Clone both receptors and compare their response profiles to the same odorant panel

  • Identify conserved and divergent ligands

  • Examine structural differences in binding pockets that might explain functional differences

Human and mouse olfactory receptor repertoires differ significantly. Humans have approximately 400 intact olfactory receptor genes compared to approximately 1000 in mice. Orthologous receptors may show different ligand specificities due to evolutionary divergence .

SpeciesApproximate Number of Intact OR GenesCommon PolymorphismsFunctional Impact
Human4005 alleles per OR (median)30% functional difference between individuals
Mouse1000Data not provided in search resultsStrain-dependent variations likely

What techniques can be used to study the neural circuits downstream of Olfr472 activation?

To methodically study neural circuits downstream of Olfr472 activation:

  • Generate Olfr472-Cre mice for selective manipulation of Olfr472-expressing neurons

  • Use viral tracing methods to map connections from Olfr472 glomeruli to higher brain regions

  • Employ in vivo calcium imaging to visualize activity propagation through the circuit

  • Utilize optogenetic or chemogenetic techniques to selectively activate or inhibit components of the circuit

  • Correlate circuit activation with behavioral responses

This circuit-level analysis builds upon the established organizational principle where OSNs expressing the same receptor converge to form specific glomeruli in the olfactory bulb, which then connect to higher processing centers .

How can CRISPR/Cas9 technology be applied to study Olfr472 function?

CRISPR/Cas9 technology offers several methodological approaches for Olfr472 research:

  • Gene knockout: Create Olfr472-null mice to study the receptor's role in odor detection

  • Knock-in reporters: Insert fluorescent proteins to track Olfr472-expressing neurons

  • Base editing: Introduce specific mutations to study structure-function relationships

  • Conditional modification: Implement temporal control of Olfr472 expression

When designing guide RNAs, target unique regions of Olfr472 to avoid off-target effects on other olfactory receptor genes, which share significant sequence homology.

What are the cutting-edge approaches for high-throughput deorphanization of olfactory receptors including Olfr472?

The latest high-throughput approaches for olfactory receptor deorphanization include:

  • Phosphorylated ribosomal protein S6 capture followed by RNA-Seq: This sensitive in vivo approach identifies receptors enriched in odor-activated sensory neurons across concentration ranges

  • Multiplexed expression systems: These allow testing of multiple receptors simultaneously against odorant panels

  • Machine learning prediction: Algorithms trained on known receptor-ligand pairs predict novel interactions

  • Cell-free expression systems: These rapidly produce multiple receptor variants for functional testing

A combined approach using in silico prediction followed by in vitro validation and in vivo confirmation represents the most comprehensive strategy for receptor deorphanization .

Deorphanization MethodAdvantagesLimitationsApplication to Olfr472
cAMP-mediated luciferase assayHigh-throughput, quantitativeIn vitro system may not reflect in vivo functionPrimary screening of potential ligands
Ribosomal S6 phosphorylation + RNA-SeqIn vivo relevance, concentration-dependent profilingRequires specialized equipment and expertiseConfirmation of in vitro findings, concentration-response profiling
Molecular dynamics simulationPredicts binding interactions, guides mutagenesisRequires structural data or reliable modelsStructure-function analysis, rational ligand design
Calcium imaging of labeled OSNsDirect visualization of cellular activationTechnical challenges in imaging intact tissueValidation of ligand specificity in native neurons

These approaches collectively provide a comprehensive framework for investigating Olfr472 function within the broader context of olfactory coding mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.