Recombinant Mouse Olfactory receptor 473 (Olfr473)

Shipped with Ice Packs
In Stock

Description

Interaction Network

Olfr473 couples with G-proteins and downstream signaling modulators, as identified via STRING database analysis :

Interacting ProteinRole in SignalingInteraction Score
GnalGuanine nucleotide-binding protein G(olf) subunit alpha; mediates cAMP signaling0.704
Gnb1Gβ subunit; modulates GTPase activity and effector interaction0.678
Arrb1/2Arrestins; regulate receptor desensitization and internalization0.672
Grk2/3G-protein-coupled receptor kinases; phosphorylate agonist-occupied receptors0.670

AAV Overexpression Constructs

ParameterDetails
Vector TypeAAV1, AAV2, AAV5, AAV8, AAV9, or synthetic capsids (e.g., AAV-DJ)
PromoterCMV (default) or 30+ optional ubiquitous/cell-specific promoters
Reporter TagsOptional GFP, CFP, YFP, or mCherry
ApplicationsIn vivo studies of olfactory signaling, receptor localization, and GPCR pharmacology

Recombinant Protein

  • Purity: >90% via E. coli expression and affinity chromatography.

  • Immunogen: Full-length protein used for antibody generation.

Research Applications

  • Functional Studies: AAV-mediated ectopic expression in olfactory sensory neurons (OSNs) enables real-time imaging of odorant-evoked calcium dynamics .

  • Ligand Screening: Recombinant Olfr473 is used in vitro to characterize agonist/antagonist profiles, though functional outputs may differ in native cellular environments .

  • Structural Biology: His-tagged protein facilitates crystallization and cryo-EM studies of GPCR activation mechanisms .

Challenges and Considerations

  • Cellular Context Dependency: Antagonist effects observed in heterologous systems (e.g., cell culture) may not replicate in vivo due to differences in G-protein abundance or signaling kinetics .

  • Stability: Repeated freeze-thaw cycles degrade recombinant Olfr473; single-use aliquots are recommended .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements you may have. Please specify your desired format in the order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To enhance long-term storage stability, we recommend adding 5-50% glycerol (final concentration) and aliquotting the solution for storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself. Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms can be stored for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to avoid repeated freeze-thaw cycles, which can compromise protein integrity.
Tag Info
The specific tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please inform us, and we will prioritize fulfilling your request during production.
Synonyms
Olfr473; Mor204-4; Olfactory receptor 473; Olfactory receptor 204-4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Olfr473
Target Protein Sequence
MEAENHTTVAELIILGLTEDPKLCIVFFVIFLGVYIVTLVGNISIITLIRISSQLHTPMY LFLSHLAFVDILYSTSVSVIMHMELLGHGLALPVAACAAQLCITVSFGSAECFLLAAMAY DRYVAICSPLLYSTLMSPRVCFLLLGMSYVGGCMNGWTFTGCLLSLSFCGPNQIDHFFCD FSPLLKLSCSDVSIIGIIPSISSGSIIVVTVFVIAVSYIYILITILNMRSTEGRHKAFST CTSHLTAVTLYYGTITFIYVMPKSNYSTEQNKVLSVFYTVVIPMLNPLIYSLRNRDVKEA LRKATVRVYS
Uniprot No.

Target Background

Function
Potential odorant receptor.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the genomic organization and expression pattern of Olfr473 in mouse olfactory epithelium?

Olfr473 belongs to the extensive family of olfactory receptors that function as G-protein coupled receptors (GPCRs) in mice. Like other olfactory receptors, Olfr473 features the characteristic seven transmembrane (7TM) domain topology common to all GPCRs, with three extracellular loops involved in ligand binding and three intracellular loops responsible for downstream signaling .

The expression of Olfr473, similar to other OR genes, is governed by monoallelic expression, meaning that each olfactory sensory neuron selects only one allele of one OR gene to express. This expression follows the "one neuron-one receptor" rule within the olfactory sensory neuron repertoire of approximately 10 million cells . The distribution of Olfr473-expressing neurons in the olfactory epithelium appears to be stereotyped in genetically identical mice but may vary between different mouse strains due to genetic influences .

How can I confirm successful expression of recombinant Olfr473 in a heterologous system?

Confirmation of recombinant Olfr473 expression can be achieved through multiple complementary approaches:

  • RNA verification: Use RT-PCR and quantitative PCR with Olfr473-specific primers. For increased specificity, design primers that amplify fragments with <75% sequence similarity to other OR genes in the mouse genome, similar to the approach used for other olfactory receptors .

  • Protein detection: Western blotting using antibodies specific to Olfr473 or to epitope tags (e.g., FLAG, HA) incorporated into the recombinant construct.

  • Functional assays: Employ calcium imaging or cAMP assays to detect ligand-induced activation, adapting methods used for other olfactory receptors such as Olfr538 and Olfr524 .

  • Cellular localization: Perform immunocytochemistry to confirm proper membrane localization of the receptor, which is critical for functionality.

  • Use of accessory proteins: Co-express receptor transport proteins (RTPs) and receptor expression enhancing proteins (REEPs) to improve surface expression of the recombinant receptor .

What are the recommended host cells for recombinant Olfr473 expression?

Several cellular systems have proven effective for olfactory receptor expression, each with specific advantages:

Host Cell TypeAdvantagesLimitationsSpecial Considerations for Olfr473
HEK293T cellsHigh transfection efficiency, widely used for GPCR studiesMay lack certain olfactory-specific factorsRequire co-expression of Gαolf and accessory proteins
Hana3A cellsModified HEK293T cells with improved OR traffickingLimited physiological relevancePreferred for initial deorphanization studies
Primary olfactory neuronsNative cellular environmentTechnical difficulty in transfection, short lifespanBest for validation after initial characterization
Sf9 insect cellsHigh protein yield for structural studiesPost-translational modifications differ from mammalsUseful for purification of Olfr473 protein

When expressing Olfr473, consider using a heterologous expression system similar to those employed for other olfactory receptors in functional studies, such as the system used for Olfr538, Olfr902, and other receptors mentioned in the literature .

How should I design primers for cloning and detecting mouse Olfr473?

When designing primers for Olfr473 cloning and detection, follow these research-based guidelines:

  • Specificity: Design primers in regions that have minimal sequence similarity to other olfactory receptors. Target regions with <75% sequence similarity to other OR genes in the mouse genome to ensure specificity .

  • Primer parameters:

    • Length: 20-30 nucleotides

    • GC content: 40-60%

    • Melting temperature (Tm): 55-65°C with <5°C difference between primer pairs

    • Avoid secondary structures and primer-dimer formation

  • For cloning:

    • Include appropriate restriction sites with 3-6 additional nucleotides at the 5' end

    • Consider codon optimization for the expression system

    • Include sequences for epitope tags if needed for detection

  • For detection via RT-PCR/qPCR:

    • Design primers spanning exon-exon junctions to avoid genomic DNA amplification

    • Amplicon size: 70-200 bp for qPCR, 200-500 bp for standard PCR

    • Validate primer specificity using BLAST against the mouse genome

  • For in situ hybridization probes:

    • Include T7 RNA polymerase promoter sequence in the reverse primer

    • Design to amplify 300-800 bp fragments with high specificity

Following a similar approach to that used for other olfactory receptors like Olfr736 and Olfr1512, the design of specific primers is crucial for accurate detection and cloning of Olfr473 .

What is the recommended protocol for deorphanizing mouse Olfr473?

Deorphanization (identifying ligands) of Olfr473 should follow a systematic approach:

  • Heterologous expression system preparation:

    • Transfect Hana3A or HEK293T cells with Olfr473 expression construct

    • Co-transfect with Gαolf, RTP1S, and REEP1 to enhance surface expression

    • Include a reporter system (e.g., cAMP-responsive luciferase or GCaMP calcium indicator)

  • Screening methodology:

    • Initial broad screening: Test diverse odorant panels including aldehydes, ketones, esters, alcohols, and terpenes at multiple concentrations (10^-6 to 10^-3 M)

    • Dose-response analysis: For potential ligands, perform detailed concentration curves (10^-9 to 10^-3 M)

    • Structural analog testing: Once hits are identified, test structural analogs to determine structure-activity relationships

  • Validation approaches:

    • In vitro confirmation: Repeat positive responses in independent experiments

    • In vivo validation: Employ the phosphorylated S6 ribosomal subunit immunoprecipitation (pS6-IP) method, which identifies activated OSNs in vivo after odorant exposure

    • Comparative analysis: Compare responses to those of phylogenetically related ORs

  • Data analysis:

    • Calculate EC50 values for active ligands

    • Determine efficacy (maximum response) relative to a reference agonist

    • Generate structural models of ligand-receptor interactions

This approach follows established methodologies used for successful deorphanization of other olfactory receptors, such as Olfr538's response to (R)-carvone and Olfr524's response to heptanal .

How does genetic variation affect Olfr473 expression and function across different mouse strains?

Genetic variation significantly impacts olfactory receptor expression and function across mouse strains, with potential implications for Olfr473:

  • Expression variation:
    The abundance of OR mRNAs shows significant variation between mouse strains. Research demonstrates that OSN subtype distribution is stereotyped in genetically identical mice but varies extensively between different strains . For Olfr473, this suggests that its expression level and the number of neurons expressing it may differ substantially between common laboratory strains (e.g., C57BL/6J vs 129).

  • Functional differences:
    Genetic polymorphisms in OR coding sequences can alter receptor function through:

    • Changes in ligand binding properties

    • Alterations in signal transduction efficiency

    • Differences in receptor trafficking and surface expression

  • Regulatory mechanisms:
    Cis-acting genetic variation has been identified as the greatest component influencing OSN composition, independent of OR function . This suggests that polymorphisms in enhancers, promoters, or other regulatory elements affecting Olfr473 could significantly impact its expression pattern.

  • Methodological approach to investigate strain differences:

    • Comparative RNAseq analysis of whole olfactory mucosa (WOM) from different mouse strains

    • Quantitative RT-PCR targeting Olfr473 across strains

    • In situ hybridization to map spatial distribution of Olfr473-expressing neurons

    • Functional testing of Olfr473 variants in heterologous systems

    • Generation of strain-specific mouse models with tagged or modified Olfr473

These approaches would reveal how genetic background influences Olfr473 expression and function, providing insights into the individualization of olfactory perception.

How can I establish the structure-function relationship of Olfr473 through site-directed mutagenesis?

Establishing structure-function relationships for Olfr473 requires a systematic mutagenesis approach:

  • Preliminary structure prediction:

    • Generate a homology model of Olfr473 based on crystallized GPCR structures

    • Identify conserved motifs and variable regions through alignment with related ORs

    • Predict ligand binding pocket residues through computational docking simulations

  • Strategic mutation design:

    • Binding pocket mutations: Target residues in transmembrane domains (TM3, TM5, TM6) predicted to interact with ligands

    • Activation-related mutations: Focus on the DRY motif in TM3 and NPxxY motif in TM7

    • Trafficking mutations: Examine N-terminal and C-terminal regions affecting surface expression

    • Conservative vs. non-conservative substitutions: Compare effects of subtle vs. dramatic amino acid changes

  • Functional characterization:

    • Measure ligand binding affinities for each mutant

    • Assess signal transduction capabilities using calcium imaging or cAMP assays

    • Quantify surface expression levels through immunocytochemistry and ELISA

    • Determine structural stability using thermal denaturation assays

  • Data integration:

    • Map mutation effects onto the structural model

    • Generate a comprehensive table correlating specific residues with functional properties

    • Identify critical residues that define Olfr473's ligand specificity

This approach will provide insights into how specific structural elements of Olfr473 contribute to its functional properties, following principles established in studies of GPCR structure-function relationships .

What methodologies can be used to investigate Olfr473 expression changes in response to odorant exposure?

To investigate how environmental odorant exposure modulates Olfr473 expression, implement these research-based methodologies:

  • Long-term odorant exposure paradigm:

    • Design an exposure system similar to the odorized drinking water approach, which allows continuous odorant exposure without adaptation

    • Test both single odorants and complex mixtures

    • Establish appropriate control groups with non-odorized conditions

    • Implement varying exposure durations (24 hours to 24 weeks)

  • Expression analysis techniques:

    • Transcriptome-wide RNAseq: Sequence RNA from whole olfactory mucosa of exposed and control animals

    • Targeted qRT-PCR: Use TaqMan probes specific to Olfr473 for validation and quantification

    • In situ hybridization: Map spatial changes in Olfr473 expression

    • Single-cell RNAseq: Determine changes in the proportion of Olfr473-expressing neurons

  • Activation mapping:

    • Implement phosphorylated S6 ribosomal subunit immunoprecipitation (pS6-IP) followed by RNAseq to identify OR genes expressed in activated OSNs after acute odorant exposure

    • Compare activation patterns between naive and pre-exposed animals

  • Functional consequences assessment:

    • Electro-olfactogram (EOG) recordings to measure population responses

    • Calcium imaging of OSNs to assess neuronal sensitivity

    • Behavioral testing to determine perceptual consequences

This multi-faceted approach would reveal whether Olfr473 expression is modulated by specific odorant exposure, similar to the reported changes for other OR genes, where exposure to odorants resulted in significant changes in mRNA levels for approximately 1.2-1.6% of OR genes in the whole olfactory mucosa .

Why is my recombinant Olfr473 not expressing properly in heterologous systems?

Poor expression of recombinant Olfr473 is a common challenge. The following troubleshooting approaches address specific issues:

  • Poor surface trafficking:

    • Problem: Many ORs, potentially including Olfr473, fail to traffic to the plasma membrane in heterologous systems.

    • Solution: Co-express receptor transport proteins (RTPs) and receptor expression enhancing proteins (REEPs) that facilitate OR trafficking. Additionally, include Gαolf and olfactory-specific chaperones .

    • Verification method: Immunocytochemistry with and without permeabilization to distinguish total vs. surface expression.

  • Protein misfolding:

    • Problem: Complex 7TM structure of Olfr473 may result in misfolding.

    • Solution: Optimize culture conditions (lower temperature to 30°C), add chemical chaperones (4-phenylbutyrate), or create fusion constructs with well-expressed proteins (e.g., rhodopsin N-terminus).

    • Verification method: Western blot to check for aggregation vs. properly folded protein.

  • Toxic effects on host cells:

    • Problem: Overexpression of membrane proteins can stress cells.

    • Solution: Use inducible expression systems, optimize transfection conditions, or try different cell lines more tolerant to GPCR expression.

    • Verification method: Cell viability assays comparing Olfr473-transfected cells to controls.

  • Codon usage bias:

    • Problem: Non-optimal codon usage for the expression system.

    • Solution: Synthesize a codon-optimized Olfr473 gene for the specific host system.

    • Verification method: Compare expression levels between native and optimized sequences.

This methodical troubleshooting approach addresses the complex challenges of expressing olfactory receptors in heterologous systems, following principles that have been successful for other difficult-to-express GPCRs .

How can I resolve contradictory data when analyzing Olfr473 ligand responses?

When faced with contradictory results in Olfr473 ligand response studies, implement this structured approach to resolve discrepancies:

  • Methodological variables assessment:

    • Expression system differences: Compare results across different cell types (HEK293T, Hana3A, Sf9)

    • Detection method variations: Evaluate differences between calcium imaging, cAMP assays, and electrophysiology

    • Reagent quality: Test odorant purity, check for degradation or contamination

    • Protocol timing: Assess if differences in incubation times or measurement windows affect outcomes

  • Biological factors evaluation:

    • Receptor variants: Sequence Olfr473 to confirm absence of mutations

    • Accessory protein differences: Standardize co-expression of RTP1S, REEP1, and Gαolf

    • Signal normalization: Implement internal controls to account for expression level variations

    • Receptor modification state: Check for post-translational modifications affecting function

  • Data integration strategy:

    • Meta-analysis approach: Pool data across experiments with statistical weighting

    • Orthogonal validation: Confirm in vitro findings with in vivo approaches like the pS6-IP method

    • Concentration-response matrix: Test expanded concentration ranges to identify potential biphasic responses

    • Ligand interaction analysis: Investigate potential allosteric or competitive interactions

  • Reporting framework:

    • Document all experimental variables comprehensively

    • Present raw data alongside normalized results

    • Include positive and negative controls in all data presentations

    • Explicitly state limitations and potential confounding factors

This systematic approach aligns with scientific best practices and the complex nature of olfactory receptor research, where reproducibility challenges are common and must be addressed methodically.

How can single-cell transcriptomics advance our understanding of Olfr473 expression dynamics?

Single-cell transcriptomics offers unprecedented insights into Olfr473 expression dynamics:

  • Cellular heterogeneity characterization:

    • Identify the precise population of OSNs expressing Olfr473

    • Determine if subpopulations of Olfr473-expressing neurons exist with different co-expression profiles

    • Map Olfr473-expressing neurons within the complex zonation patterns of the olfactory epithelium

  • Developmental trajectory analysis:

    • Track the emergence of Olfr473-expressing neurons during development

    • Identify transcription factors and regulatory elements associated with Olfr473 selection

    • Characterize the molecular stages of OSN maturation for Olfr473-expressing cells

  • Response to environmental stimuli:

    • Monitor transcriptional changes in Olfr473-expressing neurons following odorant exposure

    • Investigate cell-type-specific responses to injury or inflammation

    • Assess the stability or plasticity of Olfr473 expression under varying conditions

  • Methodological approach:

    • Isolate OSNs from olfactory epithelium using enzymatic dissociation

    • Perform droplet-based (10x Genomics) or plate-based (Smart-seq2) single-cell RNA sequencing

    • Implement computational algorithms to identify Olfr473-expressing cells and characterize their transcriptional profiles

    • Validate findings using RNAscope or other spatial transcriptomics methods

This approach would extend our understanding beyond the whole olfactory mucosa studies that have identified OR genes with significantly altered expression following odorant exposure , providing cell-type-specific insights into the regulation and plasticity of Olfr473 expression.

What are the implications of Olfr473 transcript diversity for protein domain function?

Transcript diversity of Olfr473 has significant implications for protein domain function and receptor activity:

  • Potential alternative splicing effects:
    Research on GPCR genes indicates that transcript diversity can lead to significant protein domain variation. For human GPCRs, 83% of genes with multiple transcripts exhibit diversity in the domains they code for, with similar percentages (81% and 65%) observed in mouse and rat respectively . This suggests that Olfr473 may also have multiple transcripts coding for proteins with different domain architectures.

  • Functional consequences of domain variations:

    • N-terminal variations: May affect ligand binding properties or receptor trafficking

    • Transmembrane domain alterations: Could modify the binding pocket configuration and ligand specificity

    • Intracellular loop variations: Might influence G-protein coupling efficiency and downstream signaling

    • C-terminal modifications: Could impact receptor internalization and desensitization

  • Methodological approach to investigate transcript diversity:

    • Full-length transcript sequencing: Use PacBio or Nanopore technologies to identify all Olfr473 transcript variants

    • Domain mapping: Characterize the protein domains present in each variant using Pfam database tools

    • Functional comparison: Express each variant and assess differences in ligand binding, signaling, and trafficking

    • Structural modeling: Predict how domain variations affect 3D structure and function

  • Evolutionary perspective:

    • Compare Olfr473 transcript diversity across species

    • Assess whether transcript diversity correlates with environmental adaptation

    • Investigate selection pressures on different transcript variants

Understanding transcript diversity of Olfr473 would provide insights into the functional plasticity of this receptor and potentially explain individual variations in olfactory perception.

What are the key unresolved questions regarding Olfr473 function and expression?

Despite advances in olfactory receptor research, several critical questions about Olfr473 remain unresolved:

  • Ligand specificity and structure-function relationships:

    • What are the natural ligands for Olfr473?

    • Which specific amino acid residues determine its ligand binding properties?

    • How does Olfr473 activation translate into specific perceptual qualities?

  • Regulatory mechanisms:

    • What determines the probability of an OSN selecting Olfr473 during development?

    • How stable is Olfr473 expression throughout the lifespan of an OSN?

    • What epigenetic mechanisms regulate Olfr473 expression?

  • Circuit integration:

    • Where precisely do Olfr473-expressing neurons project in the olfactory bulb?

    • What is the convergence ratio of Olfr473-expressing neurons?

    • How does information from Olfr473-expressing neurons integrate with other sensory inputs?

  • Translational relevance:

    • Are there human orthologs of Olfr473 with conserved function?

    • Could Olfr473 serve as a model for understanding GPCR dynamics more broadly?

    • Are there disease conditions associated with altered Olfr473 function?

These questions represent important directions for future research, building upon the understanding that olfactory receptor expression is influenced by both genetic variation and environmental exposure , with potential implications for individualized olfactory perception and function.

How might advanced structural biology techniques contribute to Olfr473 characterization?

Advanced structural biology techniques offer promising approaches for comprehensive Olfr473 characterization:

  • Cryo-electron microscopy (Cryo-EM):

    • Enables visualization of Olfr473 structure without crystallization

    • Can capture different conformational states (active, inactive, intermediate)

    • Allows study of Olfr473 in complex with G-proteins or other signaling partners

    • Methodological considerations: Requires optimization of expression, purification, and sample preparation

  • X-ray free-electron laser (XFEL) crystallography:

    • Provides high-resolution structural data using microcrystals

    • Enables time-resolved studies of conformational changes during activation

    • Can capture transient intermediates in the signaling process

    • Methodological approach: Generate stable, crystallizable Olfr473 constructs through protein engineering

  • Nuclear magnetic resonance (NMR) spectroscopy:

    • Investigates dynamics and conformational changes in solution

    • Identifies ligand binding sites and protein-protein interaction interfaces

    • Provides insights into allosteric mechanisms

    • Implementation strategy: Focus on specific domains or use selective isotope labeling

  • Computational approaches:

    • Molecular dynamics simulations to study Olfr473 in membrane environments

    • Homology modeling based on related GPCRs with known structures

    • Machine learning approaches to predict ligand binding and activation

    • Integration framework: Combine experimental structural data with computational predictions

These techniques would build upon recent breakthroughs in GPCR crystallography that have dramatically advanced our understanding of receptor structures , potentially revealing the structural basis for Olfr473's ligand specificity and signaling properties.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.