Recombinant Mouse Olfactory receptor 474 (Olfr474)

Molecular Structure and Characteristics of Olfr474

Olfactory Receptor 474 (Olfr474) represents a significant member of the mouse olfactory receptor family with unique structural attributes that contribute to its specialized function. As indicated in the available data, Olfr474 is a full-length protein consisting of 310 amino acids, with sequence and structural features that classify it as a G protein-coupled receptor (GPCR) . The protein's UniProt ID is documented as Q8VFC9, and it is also known by several synonyms including Mor204-20, Olfactory receptor 474, and Olfactory receptor 204-20 .

The amino acid sequence of Olfr474 reveals its GPCR nature with seven transmembrane domains, sharing structural characteristics with neurotransmitter receptors and hormone receptors . The complete amino acid sequence is as follows: MNGGNHTSMTELFILGPTEDPTFCIAFFVIFLGVYMVTLVGNISIITLIRISSQLHTPVYLFLNHLAFVDILYSTLVSVIMLMELLEHELALPVAACAAELCITVLFGSSECFLLAAMAYDCYVAICSPLLYSTLMSSRVCFLLLGMSYVGGCMNGWIFTGCLLNLSFYGPYQIDHFFCDFSPLLLKLSCSDVSIIGIIPSISSGSIIVVTVLVIAVFYICILMTILKMHSTDGCHKAFSTCNSYLTAVTLYYGTITFIYVMPKSNYSTEKNKVLSEFYTVVIPMLNHLIYSLKNRDVKDALRKAIVRVYT . This sequence determination is essential for understanding the receptor's binding capabilities and interactions with odorant molecules.

The three-dimensional structure of Olfr474, like most olfactory receptors, features the characteristic seven transmembrane α-helical domains arranged in a bundle. This arrangement creates a binding pocket that recognizes specific odorant molecules, initiating a signaling cascade that ultimately leads to odor perception. The structural characteristics of Olfr474 determine its odorant selectivity profile, contributing to the remarkable discriminatory capacity of the olfactory system .

Functional Role of Olfr474 in Olfaction

Olfr474 serves a pivotal role in the initiation of neuronal responses underlying the perception of various odors. As a G protein-coupled receptor, Olfr474 operates through a signal transduction mechanism that begins with the binding of specific odorant molecules to the receptor's binding pocket . This binding event triggers conformational changes in the receptor, enabling interaction with G proteins and setting off a cascade of intracellular signaling events.

The primary function of Olfr474 involves the recognition and transmission of olfactory signals within the nasal cavity through G protein-mediated pathways, making substantial contributions to the complex world of olfactory experiences . When odorant molecules bind to Olfr474, the receptor activates G proteins, particularly Golf, which subsequently activates adenylyl cyclase III (ACIII). This activation results in the production of cyclic adenosine monophosphate (cAMP), which in turn opens cyclic nucleotide-gated (CNG) channels, allowing an influx of calcium ions that depolarize the olfactory sensory neuron .

Research on olfactory receptors has demonstrated that the absence of olfactory marker protein (OMP) in knockout mouse models leads to reduced response to odors, slowed response kinetics, and diminished ability to respond to secondary stimulation in paired-pulse adaptation protocols compared to wild-type mice . These findings highlight the complexity of the olfactory signaling system and suggest that Olfr474, like other olfactory receptors, may depend on accessory proteins for optimal function.

Evidence from studies with tagged olfactory receptors in neurons lacking OMP has shown prolonged response onset, slower rising phase, and slower response termination of odorant-induced responses, indicating that proper signal transduction requires coordination between olfactory receptors and supporting proteins . Additionally, research has revealed that OMP contributes to defining the dynamic range of odorant sensitivity in olfactory sensory neurons, with knockout models showing flattened and broadened dose-response curves at lower odorant concentrations .

Recombinant Olfr474 Production and Properties

The production of recombinant Olfr474 protein represents a significant advancement in olfactory research, enabling detailed molecular and functional studies. According to available product information, recombinant full-length mouse Olfr474 protein can be produced with an N-terminal His tag in Escherichia coli expression systems . This approach allows for the generation of purified protein for various research applications, including structural analyses, interaction studies, and functional assays.

The recombinant protein typically includes the complete 310 amino acid sequence of Olfr474, maintaining the intact functional domains necessary for odorant binding and G protein interaction. The addition of an N-terminal His tag facilitates purification through affinity chromatography, resulting in protein preparations with purity levels greater than 90% as determined by SDS-PAGE .

Table 1: Properties of Recombinant Full-Length Mouse Olfr474 Protein

The production of recombinant Olfr474 typically involves several key steps: (1) gene cloning into an appropriate expression vector, (2) transformation of E. coli cells, (3) induction of protein expression, (4) cell lysis and protein extraction, (5) affinity purification using the His tag, and (6) quality control and characterization. The resulting protein requires careful handling and storage, with recommendations to avoid repeated freeze-thaw cycles to maintain structural integrity and functionality .

Signaling Pathways and Mechanism of Action

Olfr474, like other olfactory receptors, participates in a complex signaling network that converts chemical detection into neural signals. The signaling cascade begins when odorant molecules bind to the receptor, causing conformational changes that facilitate interaction with G proteins . This interaction leads to the activation of adenylyl cyclase III, resulting in increased intracellular cAMP levels. The elevated cAMP opens cyclic nucleotide-gated channels, causing an influx of calcium ions and subsequent membrane depolarization, which generates action potentials that propagate to the olfactory bulb .

Research on olfactory signal transduction has identified several key regulatory components and accessory proteins that modulate receptor function. For instance, the Receptor Transporting Protein (RTP) family, particularly RTP1 and RTP2, has been shown to play crucial roles in the trafficking and functional expression of olfactory receptors on the cell surface . Studies with RTP1,2 double knockout (RTP1,2DKO) mice have demonstrated diminished but not abolished responses to odors, suggesting that these proteins enhance receptor function but are not absolutely required for all olfactory receptors .

The complexity of olfactory receptor signaling is further illustrated by research on the unfolded protein response (UPR) in olfactory sensory neurons. Data suggest that delivery of olfactory receptors to the membrane plays a role in terminating the UPR, with properly trafficked receptors showing reduced expression of UPR markers . This indicates a feedback mechanism between receptor trafficking, expression, and cellular stress responses that may be relevant to understanding Olfr474 function.

Calcium signaling represents another critical aspect of Olfr474 function, with calcium influx through cyclic nucleotide-gated channels triggering a series of downstream events, including activation of calcium-dependent chloride channels that amplify the depolarizing signal . This amplification mechanism enhances sensitivity to odorants and contributes to the remarkable detection capabilities of the olfactory system.

Inhibition of Olfr474 and Research Applications

The inhibition of Olfr474 involves a coordinated interplay of various chemical inhibitors targeting specific cellular pathways essential for olfactory signal transduction. Understanding these inhibitory mechanisms provides valuable insights into the molecular complexity governing Olfr474-mediated odor perception in organisms .

Several chemical compounds have been identified as inhibitors of Olfr474 function, each acting through distinct mechanisms. These include atropine, SP600125, Wortmannin, U0126, LY294002, KN-93, and others . These inhibitors target various aspects of the signaling cascade, from receptor activation to downstream effector pathways, providing tools for dissecting the functional mechanisms of Olfr474.

Table 2: Key Inhibitors of Olfr474 Function and Their Mechanisms

These inhibitors serve as valuable research tools for investigating the functional properties of Olfr474 and other olfactory receptors. By selectively blocking specific components of the signaling pathway, researchers can dissect the molecular mechanisms underlying odorant detection and signal transduction. Additionally, these inhibitors may have potential applications in the development of modulators of olfactory function for various purposes, including the treatment of olfactory disorders or the enhancement of specific olfactory capabilities .

The study of Olfr474 inhibition also provides insights into the regulation of olfactory receptor function more broadly. Understanding how different signaling pathways contribute to receptor activity can inform research on the molecular basis of olfactory perception, including phenomena such as adaptation, sensitization, and the specificity of odorant recognition.

Role of Olfr474 in Olfactory Perception

Olfactory receptors, including Olfr474, exhibit remarkable selectivity in their response to odorant molecules, contributing to the discrimination of thousands of different odors. Each olfactory sensory neuron typically expresses a single olfactory receptor type, and neurons expressing the same receptor project their axons to specific glomeruli in the olfactory bulb, creating a spatial map of odor information . This organizational principle, known as the "one neuron-one receptor" rule, is fundamental to the coding of olfactory information in the mammalian brain.

The specificity of Olfr474 for particular odorant molecules remains an active area of research. Studies on olfactory receptors have demonstrated that these proteins can recognize multiple odorants with varying affinities, and conversely, individual odorants can activate multiple receptor types . This combinatorial coding scheme enables the discrimination of a vast array of odors with a limited number of receptor types.

Research on olfactory marker protein (OMP) has provided insights into the modulation of olfactory receptor function. Electro-olfactogram (EOG) recordings from OMP knockout mice reveal reduced response to odors and slowed response kinetics compared to wild-type animals . Furthermore, studies with green fluorescent protein-tagged olfactory receptors in neurons lacking OMP have shown prolonged response onset, slower rising phase, and slower response termination of odorant-induced responses . These findings suggest that accessory proteins like OMP contribute to the fine-tuning of olfactory receptor function, potentially including Olfr474.

The dynamic range of odorant sensitivity is another important aspect of olfactory receptor function. Research has shown that in OMP knockout mice, the dose-response curve for odorant detection is flattened and broadened at lower odorant concentrations compared to wild-type mice . This indicates that olfactory receptors, possibly including Olfr474, can be activated by odorants at much lower concentrations than typically reported, with the response characteristics modulated by accessory proteins.