Recombinant Mouse Olfactory receptor 476 (Olfr476)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Characteristics

The table below summarizes key genomic features of Olfr476:

PropertyDetails
Gene SymbolOlfr476 (MOR204-3)
OrganismMus musculus (house mouse)
Entrez Gene ID258926
Protein ClassOlfactory receptor (Class A GPCR)
SubfamilyMOR204
Chromosomal LocationUnspecified in current datasets
Tissue ExpressionOlfactory epithelium (primary site)

ORs like Olfr476 contain seven transmembrane domains and interact with odorants to initiate neuronal signaling via cAMP-mediated pathways .

Recombinant Expression and Functional Screening

While no direct studies on recombinant Olfr476 exist, methodologies for related ORs provide a framework:

Expression Systems

  • HEK-293T cells: Commonly used for OR expression with chaperones (e.g., RTP1S) and tags (Rho/Lucy) to enhance surface trafficking .

  • Detection: Fluorescent tags (e.g., Flag) quantify surface expression. Successful trafficking typically requires ≥25% surface-to-internal receptor ratio .

Ligand Screening Challenges

  • Olfr476 has no reported ligands, but ligand discovery for ORs involves:

    • In silico libraries (e.g., 500+ odorants) .

    • Luciferase reporter assays measuring cAMP elevation .

    • Focus on microbial metabolites or biofluid constituents (e.g., fungal compounds) .

Comparative Insights from Related ORs

The MOR204 and MOR256 subfamilies share structural and functional parallels:

ReceptorSubfamilyLigandsExpression Sites
Olfr476MOR204UnknownOlfactory epithelium
Olfr558MOR256Butyric acid, nonanoic acid Kidney, olfactory epithelium
MOR42-3MOR42Carboxylic acids, aldehydes Olfactory epithelium

Key observations:

  • Ligand diversity: ORs recognize structurally varied molecules (e.g., SCFAs, aldehydes) .

  • Non-olfactory roles: Some ORs regulate physiological processes (e.g., glucagon secretion, sperm chemotaxis) , though Olfr476’s extranasal functions remain unexplored.

Post-Transcriptional Regulation

Olfr mRNAs exhibit unique features impacting expression:

  • AU-rich 3′UTRs: Enhance mRNA stability and translation efficiency .

  • Short 3′UTRs: Reduce miRNA binding, favoring high expression in olfactory neurons .

  • uORF density: May modulate translational control .

These traits likely apply to Olfr476, given its classification within the Olfr family.

Research Gaps and Future Directions

  1. Ligand identification: High-throughput screens using odorant libraries (e.g., HMDB-curated compounds) are needed.

  2. Tissue-specific roles: RNA-Seq or single-cell sequencing could reveal extranasal expression.

  3. Structural studies: Cryo-EM or X-ray crystallography would elucidate Olfr476’s binding pockets.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Olfr476; Mor204-3; Olfactory receptor 476; Olfactory receptor 204-3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Olfr476
Target Protein Sequence
METQNHTTVTEFILLGLTESSTLRVILFMVFLGIYTVTLVGNFSIISLIRSCPQLHTPMY LFLSHLAFVDIGFSTSITPTMFKGFLGNRLVLSVAACIAQFCITVTFGTVECFLLAVMAY DRYVAICSPLLYSTHMSPRICFLLVGASYVGGCVNSGAFTSCLSILSFCGPNQIDHFFCD FPAVLKLSCSDVSIIGIIPSISAGSIIVITVFVIAVSYAYILITILKMRSTEGRQKAFST CTSHLTAVTLYYGTITFIYVMPKSNYSTAQNKILSVFYTVVIPMLNPLIYSLRNRDVKEA LRKAIIRIFP
Uniprot No.

Target Background

Function
Potential odorant receptor.
Database Links

KEGG: mmu:258926

UniGene: Mm.357563

Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Olfr476 and how does it fit into the olfactory receptor family?

Olfr476 is a G protein-coupled receptor (GPCR) that belongs to the largest GPCR family—the olfactory receptors (ORs). Like other ORs, it conserves common structural folds and activation mechanisms typical of GPCRs while maintaining specific ligand selectivity. The mouse genome contains more than 1000 odorant receptor genes, with Olfr476 being one of these numerous receptors that enable mice to detect and discriminate between thousands of odors . ORs function through G protein-coupled signaling pathways where receptor activation elevates intracellular cAMP levels, ultimately leading to signal transduction and olfactory perception.

How is Olfr476 expression regulated in the mouse olfactory epithelium?

The expression of Olfr476, like other ORs, is regulated through a complex system involving both regulatory DNA sequences and epigenetic modifications. Each olfactory sensory neuron expresses only one OR gene in a monoallelic fashion—a phenomenon known as "one neuron-one receptor" rule . Regulation of OR gene expression encompasses various levels of control, including specific DNA binding motifs that influence expression frequency in olfactory sensory neurons. Transcription factor binding to these motifs can be affected by genetic variations in cis-regulatory regions, which partly explains why transcript abundance of homologous OR genes varies between different mouse strains . Additionally, DNA methylation plays a critical role in OR gene regulation, although this aspect has been poorly investigated for many specific ORs including Olfr476 .

Can Olfr476 be expressed in tissues other than the olfactory epithelium?

While traditionally considered exclusive to the olfactory epithelium, recent research has demonstrated that several ORs, including other members of the OR family, are expressed in non-olfactory tissues. For example, RNA-Seq data has identified multiple ORs expressed in the murine renal cortex . Although the specific expression pattern of Olfr476 in non-olfactory tissues is not explicitly detailed in the current literature, researchers should consider examining various tissue types when studying this receptor. Techniques such as RNA-Seq followed by PCR confirmation of the full coding region have been successful in identifying ectopic OR expression .

What are the most effective methods for expressing recombinant Olfr476 in heterologous systems?

Expressing functional ORs in heterologous systems presents significant challenges due to their poor trafficking to the cell surface. Several strategies have proven effective for other ORs and should be applicable to Olfr476:

  • N-terminal tags: The use of specific tags such as Flag, Rho, and Lucy tags can significantly improve cell surface expression .

  • Chaperone protein co-expression: The receptor transporting protein 1 short (RTP1S) has been shown to facilitate OR trafficking to the cell surface .

  • Expression assessment protocol:

    • Transfect HEK-293T cells with the OR construct containing an N-terminal Flag tag

    • Perform immunocytochemistry to detect both surface (non-permeabilized) and total (permeabilized) expression

    • Quantify the ratio of cells showing surface expression ("chicken wire-like" pattern) to those with only internal expression

    • Consider the receptor viable for further studies if this ratio exceeds 25%

For successful recombinant expression of Olfr476, these approaches should be combined and optimized for this specific receptor.

How should researchers design experiments to identify ligands for Olfr476?

Ligand screening for Olfr476 can follow established protocols used for other orphan ORs. A systematic approach includes:

  • Luciferase reporter assay: Since ORs are GPCRs that couple to stimulatory G proteins, their activation elevates intracellular cAMP. Using a firefly luciferase construct under the control of a cAMP response element allows for detection of OR activation .

  • Normalization strategy: Co-transfect cells with constitutively active Renilla luciferase to normalize data for cell number, viability, and transfection efficiency. The firefly-to-Renilla luciferase signal ratio serves as an index of OR activation .

  • Compound library design: Screen Olfr476 against compounds from several strategic categories:

    • Odorants known to broadly activate a large percentage of isolated olfactory epithelium

    • Compounds that activate two or more siblings of Olfr476 (ORs in the same MOR subfamily)

    • Known ligands for sibling ORs that are found in biofluids (blood, urine, etc.)

    • Molecules classified as "odorants" present in biofluids

    • Small molecules produced by commensal or environmental microorganisms

  • Concentration determination: Test compounds at 500 μM or at the highest tolerated dose for molecules toxic at this concentration .

What techniques can be used to verify the expression levels of Olfr476 in different mouse strains?

Multiple complementary techniques can be employed to quantify Olfr476 expression levels across different mouse strains:

  • RT-qPCR: This method provides a quantitative measure of mRNA expression levels. Design primers that match regions common to Olfr476 alleles across different strains to ensure comparable amplification. Use appropriate housekeeping genes for normalization .

  • In situ hybridization: This approach allows visualization and quantification of the number of neurons expressing Olfr476 in the olfactory epithelium. Count positive cells per unit area (neurons/μm²) to compare expression frequency between strains .

  • RNA-Seq: This comprehensive approach can quantify the transcriptional profile of the complete OR repertoire across different mouse strains, providing context for Olfr476 expression relative to other ORs .

When comparing strains, researchers should note that differences in OR expression may be due to both variations in the number of neurons expressing the receptor and differences in transcript levels per neuron .

How can researchers apply proteochemometric modeling to predict Olfr476-ligand interactions?

Proteochemometric (PCM) modeling represents an advanced approach to predict OR-ligand interactions based on receptor sequence similarities and ligand physicochemical features using supervised machine learning. For application to Olfr476:

  • Sequence feature extraction: Analyze the Olfr476 amino acid sequence, particularly focusing on residues up to 8 Å around the orthosteric pocket, as these regions mostly encode ligand selectivity in ORs .

  • Model construction steps:

    • Build a 3D homology model of Olfr476 bound with potential odorants

    • Identify residues within various distance thresholds from bound odorants (e.g., poc17, poc20, poc27, poc60)

    • Test the impact of mutations on receptor response to ligands using in vitro dose-dependent assays

    • Project mutational effects onto the 3D model

  • Machine learning implementation: Construct a Random Forest (RF) classifier using residue subsets to predict Olfr476 responses to novel odorants. Validation through in vitro functional assays can achieve hit rates of up to 58% for other ORs .

  • Model evaluation: Assess the predictive power using metrics such as Matthew's correlation coefficient (MCC), with values of 0.43-0.48 being achievable for similar models .

This PCM-RF approach can significantly accelerate Olfr476-odorant mapping and potentially lead to deorphanization if Olfr476 is currently an orphan receptor.

How does genetic background influence Olfr476 function, and how can researchers control for this variable?

Genetic background significantly impacts OR gene expression and potentially function. When studying Olfr476:

What are the most effective site-directed mutagenesis approaches for studying Olfr476 structure-function relationships?

Site-directed mutagenesis provides critical insights into OR structure-function relationships. For Olfr476:

  • Target selection strategy:

    • First identify residues within 5 Å distance of bound odorants using molecular modeling (designated as poc17 in similar studies)

    • Extend the analysis to residues up to 8 Å from the bound odorant (designated as poc60 in similar studies), as these have been shown to be most relevant for decoding receptor responses to odorants

    • Focus on residues with low conservation across the OR family, as these likely contribute to ligand specificity

  • Experimental validation protocol:

    • Generate single amino acid substitutions in the Olfr476 sequence

    • Express mutant receptors in heterologous systems (e.g., HEK-293T cells)

    • Measure dose-dependent responses to known or predicted ligands

    • Quantify changes in response amplitude, sensitivity (EC50), and efficacy

  • Structural analysis:

    • Project mutational effects onto 3D models of Olfr476

    • Categorize mutations based on their impact (gain of function, loss of function, or altered specificity)

    • Identify functional domains critical for ligand binding versus those involved in signal transduction

This approach can reveal which amino acid positions in Olfr476 are crucial for recognizing specific odorants and how subtle sequence variations might contribute to differences in olfactory perception.

How should researchers interpret contradictory results in Olfr476 ligand screening assays?

When encountering contradictory results in Olfr476 ligand screening:

  • Methodological considerations:

    • Cell surface expression variability: Ensure sufficient surface expression (>25% surface-to-total expression ratio) before concluding negative results

    • Assay sensitivity: Different assay systems (calcium imaging, cAMP assays, luciferase reporters) have varying sensitivities

    • Ligand concentration: Test a wide range of concentrations, as ORs often have narrow effective concentration windows

  • Receptor-specific factors:

    • OR promiscuity: Some ORs respond to multiple ligands with varying efficacies

    • Inconsistent activation: For instance, Olfr558 showed robust activation with butyric acid but inconsistent activation with nonanoic acid despite both being reported ligands

  • Systematic approach to resolve contradictions:

    • Repeat experiments with internal positive controls

    • Compare results across different functional assays

    • Test ligand specificity against closely related ORs

    • Consider synergistic or antagonistic effects between ligands

  • Documentation recommendations:

    • Record all experimental conditions meticulously

    • Document batch information for cell lines, plasmids, and reagents

    • Report both positive and negative results with appropriate statistics

What statistical approaches are most appropriate for analyzing Olfr476 functional data?

Appropriate statistical analysis of Olfr476 functional data requires:

  • Dose-response analysis:

    • Fit data to nonlinear regression models (typically sigmoidal)

    • Calculate EC50 values (half-maximal effective concentration) with 95% confidence intervals

    • Determine Emax (maximum response) and basal activity

  • Comparison between conditions:

    • For two-group comparisons: unpaired t-tests (parametric) or Mann-Whitney tests (non-parametric)

    • For multiple group comparisons: one-way ANOVA with appropriate post-hoc tests (Tukey, Bonferroni, or Dunnett's)

    • For experiments with multiple variables: two-way ANOVA with interaction analysis

  • Machine learning applications:

    • Random Forest algorithms have shown success in OR-ligand pairing with hit rates up to 58%

    • Use Matthews Correlation Coefficient (MCC) as an appropriate metric for evaluating binary classification models in OR-ligand pairing

    • Consider cross-validation approaches to ensure model robustness

  • Reporting standards:

    • Include raw data when possible

    • Report both positive and negative results

    • Provide clear information on biological and technical replicates

    • Use standardized effect sizes and confidence intervals rather than just p-values

How can genome editing tools like CRISPR-Cas9 be applied to study Olfr476 in vivo?

CRISPR-Cas9 technology offers powerful approaches for studying Olfr476:

  • Gene knockout strategies:

    • Design guide RNAs targeting coding regions of Olfr476

    • Validate knockout efficiency through genomic PCR, RT-qPCR, and protein detection methods

    • Assess behavioral and physiological consequences of Olfr476 deletion

  • Knock-in applications:

    • Insert reporter genes (GFP, LacZ) to track Olfr476 expression patterns

    • Introduce specific mutations to study structure-function relationships

    • Create humanized versions by replacing mouse Olfr476 with human orthologues

  • Regulatory element modification:

    • Target cis-regulatory regions to study their impact on Olfr476 expression

    • Modify epigenetic marks through targeted epigenetic editors (e.g., dCas9-methyltransferase fusions)

  • Experimental considerations:

    • Design appropriate controls to account for off-target effects

    • Consider mosaicism in first-generation edited animals

    • Verify genetic modifications through sequencing

    • Establish breeding schemes to generate homozygous lines

What are the emerging high-throughput approaches for characterizing the full ligand spectrum of Olfr476?

Advanced high-throughput methods for comprehensive ligand profiling include:

  • Cell-based screening platforms:

    • Automated liquid handling systems coupled with luminescence or fluorescence plate readers

    • Microfluidic devices allowing for testing thousands of compounds simultaneously

    • Flow cytometry-based sorting of cells expressing activated receptors

  • In silico approaches:

    • Proteochemometric (PCM) models based on OR sequence similarities and ligand physicochemical features

    • Virtual screening of compound libraries against homology models

    • Machine learning algorithms (particularly Random Forest) that can achieve hit rates up to 58%

  • Combinatorial chemical libraries:

    • Focused libraries based on structural features of known OR ligands

    • Fragment-based approaches to identify molecular moieties important for receptor activation

    • Natural product libraries focused on biofluids and microbial metabolites

  • Data integration strategies:

    • Combine results from multiple screening approaches

    • Use Bayesian statistical methods to refine hit predictions

    • Apply machine learning models to predict structure-activity relationships

How might single-cell transcriptomics advance our understanding of Olfr476 expression and function?

Single-cell transcriptomics provides unprecedented insights into OR biology:

  • Cell-type specific expression:

    • Identify specific olfactory sensory neuron subpopulations expressing Olfr476

    • Characterize co-expression patterns with signal transduction components

    • Discover novel cell types expressing Olfr476 in olfactory and non-olfactory tissues

  • Developmental trajectory analysis:

    • Map the temporal dynamics of Olfr476 expression during development

    • Identify transcription factors associated with Olfr476 activation

    • Study the mechanisms of the "one neuron-one receptor" rule

  • Response profiling:

    • Compare transcriptional changes in Olfr476-expressing cells before and after odorant exposure

    • Identify downstream signaling pathways and target genes

    • Study adaptation and desensitization mechanisms at the transcriptional level

  • Spatial transcriptomics integration:

    • Combine single-cell RNA-seq with spatial information to map Olfr476-expressing cells within the olfactory epithelium

    • Correlate Olfr476 expression with anatomical zones and airflow patterns

    • Study potential functional domains within the olfactory epithelium

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.