Recombinant Mouse Olfactory receptor 477 (Olfr477)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Protein Structure:

  • Olfr477 is a Class II G-protein coupled receptor (GPCR) with 310 amino acids (1-310 full length) .

  • Contains conserved GPCR domains, including seven transmembrane helices and a KAFSTCxSH motif in the third intracellular loop critical for G-protein coupling .

  • Expressed in E. coli or mammalian systems (HEK293) with tags like His, Fc, or Avi for purification and detection .

Key Roles:

  • Olfactory Transduction: Mediates odorant detection by coupling to G₀ₗf proteins, activating cAMP pathways .

  • Stereotyped Axonal Targeting: Olfr477-expressing olfactory sensory neurons converge into spatially defined glomeruli in the olfactory bulb (~50–120 μm diameter) .

Pathway Associations:

PathwayRelated Proteins
Olfactory TransductionPRKG2, ANO2, OLFR498, OR51B2

Sequence analyses reveal 22 residues correlating with anterior-posterior glomerular positioning, including four in the G-protein-binding loop .

Genetic and Expression Variability

  • Allelic Differences: Strain-specific Olfr477 expression levels occur due to cis-regulatory polymorphisms. For example, 129-mouse strains show 30% higher neuronal expression than B6 strains .

  • Knock-in Models: P2-GFP transgenic mice exhibit reduced Olfr477 mRNA (64% decrease) despite only a 30% drop in expressing neurons, suggesting transcriptional regulation beyond cell count .

Research Applications

  • AAV Vector Studies: The pAAV-G-CMV-amp vector (Catalog No. 33183104) enables Olfr477 overexpression in vivo, with titers up to 10¹³ GC/mL .

  • Ligand Screening: Used to identify odorants binding to conserved residues (e.g., phenylalanine in KAFSTCxSH motif) .

  • Neural Circuit Mapping: Glomerular positioning data aids in decoding odorant receptor-to-bulb topographical maps .

Quality Control and Validation

  • Purity: >90% by SDS-PAGE .

  • Activity: Validated via cAMP response assays in HEK293 cells .

  • Storage: Stable at -20°C (short-term) or -80°C (long-term) .

Limitations and Considerations

  • Species Specificity: Mouse-derived Olfr477 may not fully replicate human ortholog functions .

  • Tag Interference: His/Avi tags occasionally alter ligand-binding kinetics .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein itself.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized formulations have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us and we will prioritize developing it.
Synonyms
Olfr477; Mor204-1; Olfactory receptor 477; Olfactory receptor 204-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Olfr477
Target Protein Sequence
MEAQNHTTVKEFILLGLTENSTLRVILFMIFLGIYTVTLVGNFSIISLIRSCPQLHTPMY LFLSHLALVDIGFSTSITPIMLTGFLGHTVTLSVAACVAQFCIAVTFGTVECFLLAVMAY DRYVAICSPLLYSTHMSPRICFLLVGASYVGGCVNSGTFTSCLLILSFCGPNQIDHFFCD FPAVLKLSCSDVSIIGIIPSISAGSIIVITVFVIAVSYTYILITILNMRSTEGRHKAFST CTSHLTAVTLYYGTITFIYVMPKSNYSTAQNKILSVFYTVVIPMLNPLIYSLRNRDVKEA LRKAIIRIFP
Uniprot No.

Target Background

Function
Potential odorant receptor.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Olfactory Receptor 477 (Olfr477) and how does it function in the mouse olfactory system?

Olfactory receptor 477 (Olfr477) belongs to the largest family of sensory membrane proteins in mammals. Like other olfactory receptors (ORs), it plays a critical role within the olfactory system in recognizing and discriminating structurally diverse odorous molecules. ORs function as G-protein coupled receptors (GPCRs) that, when activated by appropriate ligands, initiate signal transduction cascades resulting in odor perception .

Olfactory receptors form the chemical-detecting interface between the atmosphere and the nervous system. Each OR forms a unique small molecule binding niche within its GPCR framework, though the molecular recognition strategies used to bind and discriminate between odorants are still being elucidated for most receptors, including Olfr477 .

Why is recombinant expression of olfactory receptors like Olfr477 important for research?

Recombinant expression of ORs is crucial for understanding their structure-function relationships. The molecular basis of OR-mediated signal detection and transduction remains poorly understood due to difficulties in functional expression of ORs in high yields, which has prevented detailed structural and biophysical studies . Successful recombinant expression systems enable:

  • Determination of ligand specificity

  • Structure-function studies

  • Biophysical characterization

  • Development of biosensor applications

Similar to the successful expression of mOR256-17 (yielding 10^6 ORs per cell in transiently transfected mammalian cells), establishing efficient expression systems for Olfr477 would significantly advance our understanding of this receptor's function .

Which expression systems are most effective for producing recombinant Olfr477?

Based on findings with other olfactory receptors, mammalian cell expression systems typically yield better results than bacterial or insect cell systems for ORs. The table below summarizes comparative expression systems that could be applied to Olfr477:

Expression SystemAdvantagesLimitationsReported Yield (Other ORs)
HEK293 cellsPost-translational modifications, GPCR machinery presentHigher cost, slower growth10^6 receptors/cell
CHO cellsStable cell lines possible, low endogenous GPCR expressionTransfection efficiency variable10^5-10^6 receptors/cell
Sf9 insect cellsHigher protein yieldsGlycosylation patterns differVariable success
E. coliLow cost, high yieldInclusion bodies common, lacks post-translational modificationsLimited functional expression

For quantification and optimization of OR expression, different fluorescent probes can be employed, as demonstrated with mOR256-17. Green fluorescent protein (GFP) fusion to the C-terminus allows quantification of total cellular OR biosynthesis, while post-translational fluorescence labeling at the N-terminus enables selective visualization and quantification of ORs at the plasma membrane using flow cytometry .

How can plasma membrane trafficking of Olfr477 be improved in heterologous expression systems?

Poor trafficking to the plasma membrane is a common challenge for recombinant OR expression. Several strategies that have proven effective for other ORs and could be applied to Olfr477 include:

  • Using chaperone proteins to assist folding

  • Adding trafficking-enhancing signal sequences

  • Incorporating N-terminal tags (e.g., rhodopsin-derived sequences)

  • Optimizing codon usage for the expression system

  • Maintaining lower incubation temperatures (30-32°C instead of 37°C)

  • Co-expressing with accessory proteins like Receptor Transporting Proteins (RTPs)

Quantification of membrane expression can be achieved through N-terminal tagging with a 12-amino acid polypeptide sequence for post-translational fluorescence labeling, enabling selective visualization and quantification of ORs at the plasma membrane using cell flow cytometry .

What are the most reliable assays for measuring Olfr477 activation by potential ligands?

Several functional assays can be employed to assess Olfr477 activation:

  • Calcium flux assays: Measure intracellular calcium release upon receptor activation using fluorescent calcium indicators

  • cAMP assays: Quantify cyclic AMP production using FRET-based reporters or enzyme immunoassays

  • GTP-γS binding assays: Measure G-protein activation directly

  • β-arrestin recruitment assays: Monitor receptor internalization following activation

  • Luciferase reporter assays: Use reporter gene constructs driven by cAMP-responsive elements

When screening odorant compound libraries for Olfr477-specific agonists, a systematic approach similar to that used for mOR256-17 should be employed, which led to the discovery of a selective spectrum of potent receptor-specific agonists .

What strategies can I use to identify potential ligands for Olfr477?

Systematic approaches to identifying Olfr477 ligands include:

  • Structure-based virtual screening: Using homology models based on activated GPCR structures to predict ligand binding

  • High-throughput screening: Testing diverse odorant libraries against Olfr477-expressing cells

  • Chemical series testing: Evaluating structural analogs of known OR ligands

  • Functional group focus: Testing compounds with specific functional groups (like aldehydes) that are recognized by other ORs

When screening, it's important to consider that ORs may recognize functional groups in unexpected ways. For example, evidence suggests that some aldehyde-responsive ORs (like rat OR-I7) actually detect the aldehyde through its ability to react with water to form a 1,1-geminal (gem)-diol . This principle might apply to Olfr477 if it responds to aldehydes.

How do I distinguish between direct ligand binding and alternative activation mechanisms for Olfr477?

To determine if Olfr477 responds through direct binding or through chemical conversion of the ligand (as seen with some aldehyde-responsive receptors):

  • Compare structurally locked analogs: Test compounds that maintain the same shape but cannot undergo chemical conversion

  • Test gem-diol precursors: If aldehydes activate Olfr477, test stable gem-diol analogs directly

  • Evaluate pH dependence: Gem-diol formation is pH-dependent, so activation profiles may vary with pH

  • Use site-directed mutagenesis: Modify predicted binding site residues to alter ligand recognition

  • Time-course analysis: Reactions requiring chemical conversion may show delayed activation profiles

Homology modeling based on activated GPCR structures (like the β2-adrenergic receptor bound to ligand and G-protein) can provide insights into potential binding mechanisms .

How can I use homology modeling to predict Olfr477 ligand binding pocket structure?

Given that no olfactory GPCR crystal structures have been solved to date, homology modeling remains a valuable approach . To create reliable homology models of Olfr477:

  • Select appropriate templates: Use recently solved crystal structures of activated, ligand- and G-protein-bound GPCRs (e.g., β2-adrenergic receptor, PDB: 3SN6) rather than inactive forms

  • Validate multiple templates: Compare models based on different GPCR templates

  • Refine binding pocket: Focus on transmembrane regions involved in ligand binding

  • Incorporate molecular dynamics: Use simulations to optimize pocket geometry

  • Validate with mutagenesis: Design experiments to test the model's predictions

For example, models of rat OR-I7 based on the activated β2-adrenergic receptor have provided insights into how the receptor might accommodate the gem-diol form of aldehyde ligands .

What experimental approaches can validate computational predictions about Olfr477-ligand interactions?

To validate computational models of Olfr477-ligand interactions:

  • Site-directed mutagenesis: Modify predicted binding site residues and measure effects on ligand affinity

  • Structure-activity relationship (SAR) studies: Test series of ligand analogs to map binding pocket requirements

  • Photoaffinity labeling: Use photoreactive ligand analogs to identify binding site residues

  • Fluorescence resonance energy transfer (FRET): Measure conformational changes upon ligand binding

  • Competition binding assays: Test if predicted interactions can be disrupted by competitive ligands

These approaches should be combined with functional assays to correlate binding with receptor activation.

How can I address the problem of receptor promiscuity when studying Olfr477?

Odorants are recognized by multiple ORs, and one OR can respond to multiple odorants, creating challenges for specificity studies . To address this:

  • Use concentration-response curves: Test across wide concentration ranges to determine specificity windows

  • Compare structurally related ligands: Identify structural features that confer selectivity

  • Employ antagonist studies: Determine if responses can be selectively blocked

  • Use knockout/knockin approaches: Compare responses in systems with and without Olfr477

  • Consider behavioral outputs: Remember that activation of single ORs (like Olfr1019) can induce specific behaviors, even though other receptors may also respond to the same ligand

What methodological limitations should I consider when analyzing Olfr477 function?

Several methodological limitations should be addressed in Olfr477 research:

  • Expression level variability: Normalize responses to receptor expression levels

  • Cell system artifacts: Validate findings across multiple expression systems

  • Receptor desensitization: Design protocols to account for response adaptation

  • Ligand volatility and solubility: Ensure consistent ligand delivery

  • Signal-to-noise challenges: Implement appropriate controls and statistical analysis

  • Potential for receptor dimerization: Consider oligomeric states in analysis

Be transparent about these limitations when reporting findings, similar to how research methodology papers acknowledge limitations of various study designs 4.

How do findings from recombinant Olfr477 studies translate to understanding olfactory coding in vivo?

While recombinant expression systems provide valuable insights, translating these findings to understanding in vivo function requires consideration of:

  • Receptor expression patterns: Map Olfr477 expression in the olfactory epithelium

  • Glomerular targeting: Identify glomeruli receiving input from Olfr477-expressing neurons

  • Co-expression patterns: Determine if Olfr477 is co-expressed with other receptors

  • Behavioral correlates: Link Olfr477 activation to specific behaviors

  • Species differences: Compare findings across mouse strains and other species

Remember that activation of individual ORs can induce specific behavioral outputs. For example, activation of Olfr1019, one of the receptors for TMT, induces immobility in mice. In Olfr1019 knockout mice, this response is reduced but not entirely abolished due to the presence of other TMT-responsive glomeruli .

What analytical approaches are best for interpreting contradictory findings in Olfr477 research?

When faced with contradictory findings:

  • Systematic review methodology: Apply structured approaches to compare contradictory results

  • Meta-analysis: Quantitatively combine data from multiple studies when possible

  • Heterogeneity examination: Identify methodological differences that might explain contradictions

  • Replication studies: Design experiments specifically to address contradictions

  • Cross-validation: Test findings using complementary methodologies

The research methodology should be clearly documented to allow for reproducibility, following the principles outlined for quality research design and reporting4.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.