Recombinant Mouse Olfactory receptor 491 (Olfr491)

Shipped with Ice Packs
In Stock

Description

Functional Role in Olfaction

Olfr491 participates in olfactory signal transduction through interactions with guanine nucleotide-binding proteins (G proteins) :

  • Key Partners:

    • Gnal (Gα-olf): Mediates cAMP signaling (Score: 0.726) .

    • Gnb1/Gng7: Forms Gβγ heterotrimers critical for adenylyl cyclase activation .

  • Activation Mechanism:

    • Binds odorants, triggering Gα-olf activation and cAMP production, which opens cyclic nucleotide-gated ion channels .

Genetic Regulation and Variability

Studies reveal that Olfr491 expression is influenced by cis-acting genetic elements, independent of receptor function :

  • Strain-Specific Variation: OSN (olfactory sensory neuron) subtypes expressing Olfr491 differ in abundance between mouse strains (e.g., C57BL/6J vs. others) .

  • Environmental Modulation: Prolonged odorant exposure (e.g., acetophenone) subtly alters OSN subtype populations, including those expressing Olfr491 .

Research Applications

Recombinant Olfr491 is utilized in:

  1. Ligand Screening: High-throughput identification of activating odorants via GPCR assays .

  2. Structural Studies: Investigating 7-transmembrane domain architecture .

  3. Neuronal Diversity Mapping: RNAseq quantifies OSN subtype distribution across genetic backgrounds .

Key Research Findings

  • RNAseq Validation: OR mRNA levels correlate with OSN abundance (rho = 0.89) .

  • Single-Cell Profiling: Olfr491 mRNA levels in individual OSNs do not correlate with WOM-wide expression, supporting abundance-driven detection .

  • Odorant Specificity: Identified as responsive to acetophenone in combinatorial coding studies .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery information.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Olfr491; Mor204-11; Olfactory receptor 491; Olfactory receptor 204-11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Olfr491
Target Protein Sequence
MEPGNHTAVTKFILLGLTDDPTLCVIFFVFFLGIYIVTLVGNISIINLVRSCPQLQTPMY MFLSHLAFVDIGYSTSVTPIMLIGFIVHETGLPVHACEAQLCSVVTFGTAECFLLAAMAY DRYVAICSPLLYSTHMSSQICLLLVGASYVGGCVNAWTFTGCLLSLSFCGPNKIDHFFCD FSPLLKLSCSDVSIIGIIPSISAGSIIVVTVFVISVSYIYILITILKMRSTEGRHKAFST CTSHLTAVTLYYGTITFIYVMPKSSYSTKQNRVVSLFYTVVIPMLNPLIYSLRNRDVKEA LRKATLRIYS
Uniprot No.

Target Background

Function
Potential odorant receptor.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Olfr491 and what is its functional role in the mouse olfactory system?

Olfr491 is one of over 1,000 odorant receptor genes expressed in mice that map to specific glomeruli in the olfactory bulb . As an olfactory receptor, it belongs to the G protein-coupled receptor superfamily and is responsible for detecting specific odorant molecules in the environment. Olfactory receptors like Olfr491 are expressed in olfactory sensory neurons (OSNs) in the main olfactory epithelium.

Each olfactory sensory neuron typically expresses only one odorant receptor gene, and neurons expressing the same receptor project their axons to specific glomeruli in the olfactory bulb, creating a precise spatial map of odor information . This principle of "one neuron-one receptor" and the convergence of like neurons to specific glomeruli forms the basis of odor coding in the olfactory system.

While the specific odorants that activate Olfr491 have not been fully characterized in the provided research, studies using techniques such as phosphorylated ribosome immunoprecipitation followed by RNA-Seq have been employed to identify receptor-odorant pairs in similar contexts .

How does Olfr491 compare to other olfactory receptors in terms of expression patterns?

Olfactory receptors in mice are categorized into distinct classes, including Class I and Class II receptors, as well as specialized families like the Trace Amine-Associated Receptors (TAARs) . Each receptor class shows specific expression patterns and projection domains within the olfactory bulb.

While the exact expression domain of Olfr491 is not explicitly detailed in the search results, olfactory receptors generally exhibit zonal expression patterns within the olfactory epithelium. Studies have shown that some olfactory receptors, such as Olfr160 (M72), Olfr690 (MOR31-2), and Olfr961 (MOR224-5), are expressed in the dorsal region of the olfactory epithelium, while others like Olfr2 (I7) and Olfr1440 (MOR215-1) are expressed ventrally .

To determine the specific expression pattern of Olfr491, researchers typically use in situ hybridization with receptor-specific probes combined with immunostaining techniques to visualize the distribution of the receptor across the olfactory epithelium .

What genomic and protein structure characteristics define Olfr491?

Based on the available information, Olfr491 gene has been characterized in both laboratory mice (Mus musculus) and prairie deer mice (Peromyscus maniculatus bairdii). In the prairie deer mouse, the gene is identified as LOC102925948 with reference sequence accession XM_006991780.2 .

The olfactory receptor 491 protein in prairie deer mouse is encoded by an open reading frame (ORF) of 933 base pairs . Like other olfactory receptors, the protein structure likely contains seven transmembrane domains characteristic of G protein-coupled receptors.

The genomic sequence of Olfr491 has been sufficiently characterized to allow for the design of CRISPR guide RNAs for gene editing experiments, as demonstrated by work from Feng Zhang's laboratory at the Broad Institute . These guide RNAs are designed to specifically target Olfr491 within the mouse genome with minimal off-target effects.

What are the most effective methods for studying Olfr491 expression in the mouse olfactory system?

To study Olfr491 expression, researchers can employ several complementary techniques:

  • In Situ Hybridization (ISH): This technique uses labeled RNA probes complementary to Olfr491 mRNA to visualize its expression pattern in tissue sections of the olfactory epithelium . It provides spatial information about receptor expression across different zones of the epithelium.

  • Immunohistochemistry: If antibodies specific to Olfr491 are available, they can be used to visualize the protein expression in olfactory sensory neurons and their projections to glomeruli in the olfactory bulb.

  • Single-Cell RNA Sequencing (scRNA-Seq): This advanced technique can identify the complete transcriptome of individual olfactory sensory neurons, confirming Olfr491 expression and potential co-expressed genes.

  • Phosphorylated Ribosome Immunoprecipitation: This innovative technique, as described in the search results, allows for the identification of actively translated mRNAs in neurons that are responding to specific odorants. By stimulating mice with target odorants and then immunoprecipitating phosphorylated ribosomes (pS6) from the olfactory epithelium followed by RNA-Seq, researchers can identify which receptors, potentially including Olfr491, are activated by specific odorants .

TechniqueAdvantagesLimitationsData Output
In Situ HybridizationSpatial information, zone-specific expressionLabor-intensive, limited quantificationVisualization of receptor expression patterns
ImmunohistochemistryProtein-level confirmation, axonal projectionsRequires specific antibodies, cross-reactivity issuesVisualization of receptor protein and projections
Single-Cell RNA-SeqComprehensive gene expression profile, cell-type specificityCostly, complex data analysisQuantitative expression data at single-cell resolution
pS6 Immunoprecipitation + RNA-SeqLinks receptor activation to specific odorants, in vivo analysisComplex methodology, requires specialized equipmentQuantitative data on receptor activation by odorants

How can CRISPR-Cas9 technology be applied to study Olfr491 function?

CRISPR-Cas9 technology offers powerful tools for investigating Olfr491 function through targeted gene editing. Based on the search results, specifically designed guide RNAs (gRNAs) for Olfr491 have been developed by Feng Zhang's laboratory at the Broad Institute . These gRNAs are designed to minimize off-target effects while efficiently targeting the Olfr491 gene.

The methodology for CRISPR-based manipulation of Olfr491 includes:

  • Gene Knockout Studies: By introducing frame-shift mutations or early stop codons in the Olfr491 coding sequence, researchers can generate knockout models to study the effects of Olfr491 loss on olfactory function.

  • Reporter Gene Knock-in: CRISPR can be used to insert reporter genes like GFP at the Olfr491 locus, allowing visualization of neurons expressing this receptor without disrupting its function.

  • Point Mutation Studies: To investigate structure-function relationships, specific amino acid residues can be mutated to determine their importance for odor recognition or signaling.

For optimal results when targeting Olfr491, the search results recommend:

  • Using at least two different gRNA constructs to increase the chance of successful gene editing

  • Verifying the gRNA sequences against the target gene sequence before ordering, especially when targeting specific splice variants or exons

  • Using sequence-verified plasmids containing all elements required for gRNA expression and genome binding: the U6 promoter, spacer sequence, gRNA scaffold, and terminator

What are the recommended methods for functional characterization of Olfr491?

To characterize the functional properties of Olfr491, researchers can employ various experimental approaches:

  • Heterologous Expression Systems: Expressing Olfr491 in cell lines such as HEK293 cells along with the appropriate G proteins and reporter systems allows for screening of potential ligands that activate the receptor. This approach has been successfully used to validate odorant receptor-ligand pairs identified through in vivo methods .

  • Calcium Imaging: When Olfr491 is expressed in cells along with calcium-sensitive fluorescent indicators, receptor activation by cognate odorants can be visualized as changes in intracellular calcium levels.

  • In Vivo Functional Mapping: As described in the search results, phosphorylated ribosome immunoprecipitation (pS6-IP) followed by RNA-Seq from odor-stimulated mice can identify receptors activated by specific odorants. This technique screens endogenously expressed odorant receptors against odors in awake, freely behaving mice .

  • Glomerular Imaging: Since olfactory sensory neurons expressing the same receptor project to specific glomeruli, imaging techniques such as intrinsic signal imaging or calcium imaging of the olfactory bulb can reveal glomeruli activated by odorants that might bind to Olfr491.

The pS6-IP method has been experimentally validated with known receptor-odorant pairs, including:

  • Olfr690 (MOR31-2) activated by isovaleric acid

  • Olfr961 (MOR224-5) activated by eugenol

  • Olfr2 (I7) activated by heptanal

  • Olfr1440 (MOR215-1) activated by muscone

  • Olfr160 (M72) activated by acetophenone

This validation demonstrates the utility of the method for identifying novel receptor-odorant pairs, potentially including those involving Olfr491.

How does the evolutionary conservation of Olfr491 compare across species?

Olfactory receptors are known to be highly divergent across species due to evolutionary adaptations to different ecological niches and olfactory environments. Based on the search results, we can identify that Olfr491 has been characterized in both laboratory mice (Mus musculus) and prairie deer mice (Peromyscus maniculatus bairdii) .

In the prairie deer mouse, the gene is annotated as LOC102925948 and is described as encoding an "olfactory receptor 491" protein . This conservation between species suggests that Olfr491 may recognize odorants relevant to multiple rodent species.

For a comprehensive evolutionary analysis of Olfr491, researchers would typically:

  • Conduct sequence alignment analyses with orthologous genes from different species

  • Calculate sequence identity and similarity percentages

  • Perform phylogenetic analyses to determine evolutionary relationships

  • Identify conserved functional domains and potential ligand-binding residues

Comparative analysis of Olfr491 with related olfactory receptors can provide insights into the evolutionary pressures that have shaped its function and specificity.

What is the relationship between Olfr491 and specialized olfactory subsystems?

The mouse olfactory system contains multiple specialized subsystems, each optimized for detecting specific classes of chemical stimuli. Based on the search results, we know that certain receptor families, such as the Trace Amine-Associated Receptors (TAARs), form distinct projection patterns in the olfactory bulb and are specialized for detecting specific chemical classes like volatile amines .

While the specific subsystem association of Olfr491 is not explicitly mentioned in the search results, olfactory receptors generally belong to either Class I or Class II receptors, each mapping to distinct domains in the olfactory bulb . Additionally, the search results describe a TAAR projection that is distinct from the previously described Class I and Class II domains .

To determine whether Olfr491 belongs to a specialized subsystem, researchers would need to:

  • Map the glomerular projections of Olfr491-expressing neurons in the olfactory bulb

  • Determine if these projections coincide with known specialized domains

  • Identify the chemical classes that activate Olfr491

  • Analyze the developmental origin of Olfr491-expressing neurons

Understanding the subsystem association of Olfr491 could provide insights into its evolutionary and functional significance in odor detection.

What methodological challenges exist in studying ligand specificity for Olfr491?

Determining the specific odorants that activate Olfr491 presents several methodological challenges that researchers must address:

  • Heterologous Expression Difficulties: Olfactory receptors, including Olfr491, are often difficult to express functionally in heterologous cell systems due to poor trafficking to the cell surface and low expression levels. Researchers often need to use receptor trafficking enhancers or chimeric constructs to improve expression.

  • Ligand Diversity: The potential ligand space for olfactory receptors is enormous, making comprehensive screening challenging. Researchers typically start with structurally related odorants or use computational approaches to predict potential ligands.

  • Concentration-Dependent Responses: Olfactory receptors can respond to multiple odorants at different concentrations, complicating the definition of the "true" ligand. The search results mention that TAARs are activated by low concentrations of amines, suggesting high sensitivity . Similar concentration studies would be needed for Olfr491.

  • In Vivo Validation: Confirming that in vitro responses translate to in vivo function requires sophisticated techniques. The pS6 immunoprecipitation method described in the search results provides a powerful approach but requires careful validation .

ChallengePotential SolutionMethodological Approach
Poor heterologous expressionReceptor trafficking enhancersUse RTP1S, Ric8b, or receptor chimeras to improve surface expression
Large ligand spaceFocused screening approachStart with chemically related compounds or computationally predicted ligands
Concentration-dependent responsesDose-response curvesTest multiple concentrations of candidate ligands (e.g., 10⁻⁹ to 10⁻³ M)
In vivo validationCombining techniquesUse in vitro screening followed by in vivo validation with pS6-IP or glomerular imaging

How should experiments be designed to study Olfr491 expression during development?

Studying the developmental expression of Olfr491 requires a systematic approach that captures temporal and spatial changes in receptor expression. Based on the principles of research methodology described in the search results6, a comprehensive experimental design should include:

  • Temporal Expression Analysis:

    • Collect olfactory epithelium samples at multiple developmental timepoints (e.g., embryonic days E12, E14, E16, E18, postnatal days P0, P7, P14, P21, and adult)

    • Extract RNA and perform quantitative RT-PCR or RNA-Seq to measure Olfr491 expression levels across development

    • Normalize expression to appropriate housekeeping genes or use spike-in controls for accurate quantification

  • Spatial Expression Analysis:

    • Perform in situ hybridization with Olfr491-specific probes on tissue sections from different developmental stages

    • Use fluorescent probes to allow co-localization studies with developmental markers

    • Quantify the number and distribution of Olfr491-expressing cells across different zones of the olfactory epithelium

  • Single-Cell Analysis:

    • Perform single-cell RNA-Seq on olfactory epithelium cells at key developmental stages

    • Identify cell clusters expressing Olfr491 and characterize their transcriptional profiles

    • Track changes in the proportion of Olfr491-expressing cells over development

The experimental data should be organized in clear, well-structured tables as suggested in the search results5, with independent variables (developmental stage, epithelial zone) and dependent variables (expression level, cell count) clearly defined.

What are the best approaches for analyzing Olfr491 activation in response to odorants?

Based on the search results, particularly the pS6 immunoprecipitation method described , researchers can employ several complementary approaches to analyze Olfr491 activation:

  • In Vivo Activation Analysis:

    • Expose awake, freely behaving mice to test odorants under controlled conditions

    • Perform pS6 immunoprecipitation from the olfactory epithelium followed by RNA-Seq

    • Quantify Olfr491 mRNA enrichment in the immunoprecipitated fraction compared to control conditions

    • Validate results using in situ hybridization with Olfr491 probe combined with pS6 immunostaining

  • Ex Vivo Imaging:

    • Prepare acute slices of the olfactory epithelium or olfactory bulb

    • Load calcium-sensitive dyes or use genetically encoded calcium indicators

    • Apply candidate odorants while imaging cellular responses

    • Identify responding cells and confirm Olfr491 expression using post-hoc immunostaining or in situ hybridization

  • Heterologous Cell Systems:

    • Express Olfr491 in HEK293 cells along with appropriate G proteins and signaling components

    • Use luciferase reporters, FLIPR, or calcium imaging to measure receptor activation

    • Screen a panel of odorants at various concentrations to determine specificity and sensitivity

    • Generate dose-response curves to calculate EC50 values for active compounds

These experimental approaches should be designed with appropriate controls and statistical analyses to ensure reproducibility and reliability of results. Data presentation should follow the guidelines for scientific tables described in the search results5, with clear organization of independent variables (odorants, concentrations) and dependent variables (activation measures).

How can computational methods enhance Olfr491 research?

Computational approaches can significantly augment experimental studies of Olfr491 by providing predictive models and data analysis frameworks:

  • Structural Modeling and Ligand Docking:

    • Generate 3D structural models of Olfr491 based on homology with crystallized GPCRs

    • Perform virtual screening of odorant libraries to identify potential ligands

    • Conduct molecular docking simulations to predict binding modes and affinities

    • Identify key amino acid residues involved in ligand recognition

  • Sequence Analysis and Comparative Genomics:

    • Align Olfr491 with related olfactory receptors to identify conserved and variable regions

    • Perform phylogenetic analysis to understand evolutionary relationships

    • Compare Olfr491 sequences across species to identify functional constraints

    • Analyze promoter regions to identify regulatory elements controlling expression

  • Transcriptomic Data Analysis:

    • Apply machine learning algorithms to single-cell RNA-Seq data to identify co-expression patterns

    • Develop computational pipelines for analyzing pS6 immunoprecipitation RNA-Seq data

    • Use dimensionality reduction techniques to visualize relationships between receptor activation patterns

    • Implement statistical methods to identify significant changes in expression or activation

  • CRISPR Guide RNA Design and Off-Target Prediction:

    • Use computational tools to design optimal guide RNAs for Olfr491 targeting

    • Predict potential off-target sites in the mouse genome

    • Optimize gRNA sequences for efficiency and specificity

    • Simulate CRISPR editing outcomes to predict mutation patterns

By integrating these computational approaches with experimental methods, researchers can develop more comprehensive and efficient strategies for studying Olfr491 function and regulation.

What are the major knowledge gaps in Olfr491 research?

Despite advances in olfactory receptor research, several significant knowledge gaps remain regarding Olfr491:

  • The specific odorant ligands that activate Olfr491 have not been comprehensively identified, limiting our understanding of its functional role in odor detection.

  • The precise glomerular targets of Olfr491-expressing neurons in the olfactory bulb and their integration into odor processing circuits remain to be fully characterized.

  • The regulatory mechanisms controlling the expression of Olfr491 during development and in adult animals are incompletely understood.

  • The potential roles of Olfr491 in non-olfactory tissues (ectopic expression) have not been thoroughly investigated.

  • The evolutionary conservation and divergence of Olfr491 across different mammalian species need further exploration to understand its biological significance.

These knowledge gaps present opportunities for researchers to make significant contributions to our understanding of Olfr491 and olfactory receptor function more broadly.

What future research directions should be prioritized for Olfr491?

Based on the current state of knowledge and methodological capabilities outlined in the search results, several research directions emerge as priorities:

  • Comprehensive Ligand Identification: Utilizing the pS6 immunoprecipitation method combined with heterologous expression systems to systematically identify and characterize the odorants that activate Olfr491.

  • Functional Genomics Approaches: Employing CRISPR-Cas9 technology with the available guide RNAs to generate Olfr491 knockout or reporter mouse models for in-depth functional studies.

  • Circuit-Level Analysis: Mapping the neural circuits initiated by Olfr491-expressing neurons to understand how the information they transmit is processed and integrated with signals from other olfactory receptors.

  • Comparative Studies: Investigating Olfr491 function across multiple species, including the prairie deer mouse where it has been annotated , to understand its evolutionary significance.

  • Development of Olfr491-Specific Tools: Creating antibodies, ligands, or genetic tools specifically targeting Olfr491 to facilitate more precise experimental manipulations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.