Recombinant Mouse Olfactory receptor 498 (Olfr498)

Shipped with Ice Packs
In Stock

Description

Functional Insights

Olfr498 operates within the canonical olfactory signaling pathway:

  1. Odorant Binding: Interacts with specific volatile molecules via distinct residues in transmembrane domains .

  2. G-protein Activation: Couples with guanine nucleotide-binding proteins (e.g., Gα(olf), Gβ₁γ₁₃) to initiate cAMP signaling .

  3. Signal Termination: Mediated by β-arrestins (Arrb1/2) and GPCR kinases (Grk2/3) .

Key functional studies include:

  • Heterologous Expression: Systems like HEK293 cells enable odorant response profiling. For example, related ORs (e.g., Olfr538, Olfr524) show dose-dependent activation to ligands like (R)-carvone and heptanal .

  • In Vivo Modulation: Chronic odorant exposure alters Olfr498 mRNA levels, suggesting activity-dependent regulation .

Interaction Network

Olfr498 forms a functional network with signaling partners identified via proteomic analyses :

Table 2: Key Interaction Partners

ProteinRole in Olfactory Signaling
Gα(olf)Activates adenylate cyclase
β-arrestinMediates receptor desensitization
GRK2/3Phosphorylates activated receptors
Vmn1r183Co-expressed vomeronasal receptor

Research Applications

Recombinant Olfr498 is critical for:

  • Deorphanization: Identifying ligands via high-throughput screens .

  • Structural Studies: Enabling cryo-EM or X-ray crystallography to resolve activation mechanisms.

  • Pathway Analysis: Mapping signaling cascades using β-arrestin recruitment assays .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preference in the order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. Should you require dry ice shipping, please communicate this need in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically exhibit a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. For multiple uses, aliquoting is essential. Repeated freeze-thaw cycles should be avoided.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Olfr498; Mor204-36; Olfactory receptor 498; Olfactory receptor 204-36
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-330
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Olfr498
Target Protein Sequence
MAFLEDGNHTTVTEFILLGLTDDPVLRDILFIIILCIYLVTVSGNLSTILLIRVSSQLHH PMYFILSHLASVDIGISSSVTPNMLATFLVKQNTISYIGCSIQFTSAAFFGTVECFLLAT MAYDRFVAICNPLLYSTKMSTEACIQLVVGSYIQGFLNASFFTLSFFSLFFCGPNRINDF YCDFAPLLELSCSDVTVAVVITSISAGFITLTTVFVIAISYSCIFITIMKMHSTESRCKA FSTCTSHLTAVILFYGTAIFIYVMPKSSYSTDQNKVLSIFYTVVIPMLNPLIYSLRNNEI KEALKRHLGKKVFSYGNLFCKTHYNHNYPV
Uniprot No.

Target Background

Function
This protein is a potential odorant receptor.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.