Recombinant Mouse Olfactory receptor 508 (Olfr508)

Shipped with Ice Packs
In Stock

Description

Functional Role in Signaling

Olfr508 interacts with guanine nucleotide-binding proteins (G proteins) to regulate adenylyl cyclase activity, a critical enzyme in cAMP signaling pathways . Key functional partners include:

Interacting ProteinRoleInteraction Score
Gnal (Gα-olf)Mediates cAMP production via adenylyl cyclase activation 0.703
Gnb1 (Gβ1)Forms heterotrimers with Gα-olf to stabilize signaling complexes 0.678
Arrb1/2 (β-arrestins)Facilitates receptor desensitization and internalization 0.672

This receptor is implicated in neural signal modulation, particularly in brain regions linked to olfactory processing .

Research Applications

Recombinant Olfr508 is widely used in:

  • Odorant Screening: Identifies ligands via high-throughput assays .

  • Structural Studies: Enables cryo-EM or X-ray crystallography to resolve GPCR activation mechanisms .

  • Signal Transduction Assays: Measures cAMP dynamics in response to odorants .

Expression and Purification Protocols

  • Expression System: E. coli (most common) , with alternatives in yeast or mammalian cells .

  • Purification: Affinity chromatography using His tags .

  • Reconstitution: Requires solubilization in Tris/PBS buffers with glycerol to prevent aggregation .

Stability and Handling

  • Lyophilized Stability: 12 months at -80°C .

  • Working aliquots: Stable for 1 week at 4°C .

  • Critical Note: Avoid freeze-thaw cycles to prevent denaturation .

Challenges and Innovations

Functional studies of Olfr508 face hurdles common to ORs, such as low expression yields and ligand promiscuity . Advances include:

  • Fluorescent tagging for real-time trafficking studies .

  • Chimeric receptors to enhance surface expression in heterologous systems .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. If you have specific format requirements, kindly indicate them in your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final concentration of glycerol is 50%, serving as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended to minimize freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag.
Synonyms
Olfr508; Mor204-6; Olfactory receptor 508; Olfactory receptor 204-6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Olfr508
Target Protein Sequence
MEPGNYTVVTEVILLGFTEDAIIRAILFIVFLIIYSVTLMGNASIIMLIRRSPQLHTPMY LLLSHLAFVDIGYSSSVTPIMLKGFLRKETFILVSGCVAQLCSVVTFGSTECFLLAAMAY DRYVAICSPLLYATQMSSTVCILLVGASYLGGCVNAWTFTGCLLNLSFCRPNKVNHFFCD YSPLLKISCSHDFSSEVIPAISSGSIIVVTVFIIALSYVYILVSILKMRSTEGRQKAFST CTSHLTAVTLFYGTITFIYVMPKSSYSTDQNKVVSVFYTVVIPMLNPIIYSLRNKDVKEA MKKLMANTHH
Uniprot No.

Target Background

Function
Potential odorant receptor.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the functional significance of Olfr508 in the mouse olfactory system?

Olfr508 is one of hundreds of olfactory receptors (ORs) expressed in mouse olfactory sensory neurons (OSNs). Like other mammalian ORs, it plays a crucial role in the detection and discrimination of odors. The functional characterization of specific ORs like Olfr508 remains challenging but essential for understanding the olfactory code . While the specific ligands for Olfr508 are still being investigated, studying this receptor contributes to our understanding of how mammals detect and process olfactory information.

How does Olfr508 compare structurally to other characterized mouse olfactory receptors?

Olfr508 belongs to the G protein-coupled receptor (GPCR) superfamily, characterized by seven transmembrane domains. While detailed structural comparisons would require specific studies on Olfr508, research on other mouse ORs like Olfr73 provides insights into potential structural and functional similarities. The binding pocket and transmembrane regions likely determine ligand specificity, similar to other characterized ORs such as Olfr73, Olfr599, and Olfr960 .

What expression systems are suitable for studying recombinant Olfr508?

Based on research with other olfactory receptors, there are two primary approaches to studying recombinant Olfr508:

In vitro expression systems:

  • Heterologous cell culture systems (typically HEK293 cells)

  • Coupling to G proteins (either native Golf or promiscuous Gα15)

  • Reporter systems using cAMP-dependent response elements

In vivo expression systems:

  • AAV-mediated gene delivery to olfactory sensory neurons

  • Transgenic mouse models expressing Olfr508 with reporter genes

  • Ectopic expression in other OSN populations

What are the most effective methods for expressing recombinant Olfr508 in experimental settings?

Based on successful approaches with other ORs, the following methodologies are recommended for Olfr508 expression:

Expression SystemVector/MethodAdvantagesLimitations
In vitro cell culturePlasmid vectors with strong promoters (CMV)Controlled environment, high-throughput screening potentialMay not replicate native cellular environment
Adeno-associated virus (AAV)rAAV5 with bicistronic construct (OR-IRES-reporter)Expression in native OSNs, visualization of functional activityVariable transduction efficiency, more complex implementation
Transgenic approachTargeted gene insertionStable expression, potential for generational studiesTime-consuming, costly, limited flexibility

For accurate functional characterization, the rAAV5 delivery system with a bicistronic construct (similar to that used for Olfr73) enabling expression in native OSNs is particularly promising. This approach allows visualization of the functional activity within the transduction compartment with high resolution, as demonstrated with Olfr73 and Olfr599 .

How can I design screening assays to identify ligands for Olfr508?

Effective ligand screening for Olfr508 would likely benefit from approaches successfully used with other ORs:

  • High-throughput cell-based assays:

    • G protein coupling assays utilizing Golf-dependent or Gα15 promiscuous pathways

    • cAMP detection using CRE-SEAP or CRE-luciferase reporter systems

    • Calcium imaging with fluorescent indicators

  • Molecular profiling of activated neurons:

    • Phosphorylated S6 (pS6) immunostaining following odor exposure

    • This method has successfully identified odorant-receptor pairs for Olfr690, Olfr961, Olfr2, and Olfr1440

  • ELISA-based detection:

    • Using antibodies specific to activated OR conformations

    • Quantifying receptor activation levels in response to potential ligands

When designing these assays, consider testing a diverse panel of odorants at various concentrations (typically 5 μM to 1 mM, based on studies with eugenol and Olfr73) .

What considerations should be made when selecting between in vitro and in vivo systems for Olfr508 functional studies?

The choice between in vitro and in vivo approaches significantly impacts results when studying ORs:

In vitro systems considerations:

  • May reproduce antagonism for short odor pulses but not for prolonged exposure (as observed with Olfr73)

  • Useful for initial high-throughput screening of potential ligands

  • May not accurately reflect the receptor's native functionality

In vivo systems considerations:

  • Provide more physiologically relevant understanding of ligand-OR interactions

  • Better represent the cellular environment that shapes OR functionality

  • Challenge: requires specialized equipment and expertise for in vivo imaging/recording

  • The response dynamics and concentration-dependence of agonists better reflect endogenous OR behavior

Research with Olfr73 demonstrated that antagonism observed in vitro was not replicated in vivo, suggesting that "characterizing ORs in 'native' conditions, rather than in vitro, provides a more relevant understanding of ligand-OR interactions" .

How do cellular environment and stimulus dynamics affect Olfr508 functionality?

Research with Olfr73 has revealed important insights that may apply to Olfr508:

  • Cellular environment effects:

    • The functional properties of ORs differ significantly between heterologous expression systems and native OSNs

    • Signaling components, membrane composition, and trafficking machinery in native OSNs can influence receptor function

    • These differences may explain why antagonism observed in vitro was not replicated in vivo for Olfr73

  • Stimulus dynamics effects:

    • Short vs. prolonged odor exposure produces different response patterns

    • Short pulses may show antagonistic effects not observed during prolonged exposure

    • Temporal dynamics of odor presentation significantly impacts observed receptor-ligand interactions

When designing Olfr508 experiments, these factors should be carefully controlled and reported. Consider examining receptor responses under both brief (seconds) and prolonged (minutes) odor exposure to capture the full range of functional dynamics.

What methodological approaches can be used to study mixture interactions at Olfr508?

Investigating how Olfr508 responds to odor mixtures versus individual components requires specialized approaches:

  • Calcium imaging with ratiometric indicators:

    • Allows real-time monitoring of receptor activation in response to sequential or simultaneous odor presentation

    • Can detect potential antagonistic, synergistic, or additive effects

  • Patch-clamp electrophysiology:

    • Direct measurement of OSN electrical responses to odor mixtures

    • Provides high temporal resolution of mixture-induced activation patterns

  • Molecular competition assays:

    • Testing potential agonist/antagonist pairs at varying concentration ratios

    • Similar to studies that identified methylisoeugenol (MIEG) as an antagonist of eugenol on Olfr73

When designing mixture experiments, systematically vary both the components and their relative concentrations to thoroughly characterize interaction effects.

How can I identify and validate antagonists for Olfr508?

Based on approaches used for other ORs like Olfr73, a multi-step strategy is recommended:

  • Initial screening:

    • High-throughput in vitro screening using the G-olf-dependent assay with cAMP-dependent upregulation of reporter genes

    • This approach was successfully used to screen 176 mouse ORs to identify inverse agonists acting as putative inhibitory ligands

  • Dose-response characterization:

    • Test candidate antagonists against known agonists at varying concentrations

    • Plot concentration-response functions to identify inhibitory effects

  • In vivo validation:

    • Critical verification step, as in vitro antagonism may not translate to in vivo settings (as observed with Olfr73)

    • Use AAV-mediated ectopic expression of Olfr508 with calcium indicators

    • Test antagonist effects under both short pulse and prolonged odor exposure conditions

  • Structural analysis:

    • Molecular modeling of ligand-receptor interactions

    • Mutagenesis studies to identify binding sites

When validating antagonists, remember that "findings of all in vitro studies should be verified in native OSNs" .

How should concentration-response data for Olfr508 be analyzed and interpreted?

Proper analysis of concentration-response data requires:

  • Normalization approaches:

    • Responses typically normalized to maximum response or to a reference odorant

    • Critical for comparing across experimental conditions or preparations

  • Curve fitting:

    • Fit to Hill equation or other appropriate dose-response models

    • Extract parameters such as EC50 (half-maximal effective concentration), Hill coefficient (cooperativity), and maximum response

  • Comparative analysis:

    • When comparing Olfr508 to other ORs, consider left- or right-shifted concentration-response functions

    • Research with Olfr73 showed that transduced mouse OSNs responded to lower concentrations (5 μM) of eugenol and showed left-shifted concentration-response functions compared to rat OSNs

  • Statistical validation:

    • Apply appropriate statistical tests to determine significance of observed differences

    • Consider using realistic research questions that are "specific, complex, and empirically verifiable"

What are the common challenges in interpreting Olfr508 functional data and how can they be addressed?

Several challenges commonly arise when interpreting OR functional data:

  • Distinguishing direct vs. indirect effects:

    • Problem: Observed responses may result from activation of other receptors or pathways

    • Solution: Use knockout/knockin approaches or heterologous expression systems with controlled OR expression

  • Variability between expression systems:

    • Problem: Different results between in vitro and in vivo systems (as observed with Olfr73)

    • Solution: Validate findings across multiple experimental paradigms

  • Temporal dynamics interpretation:

    • Problem: Response patterns change with stimulus duration

    • Solution: Analyze both peak response and temporal profile, reporting both metrics

  • Limited reproducibility:

    • Problem: Functional characterization results may vary between labs

    • Solution: Standardize protocols, report detailed methodologies, and validate with known OR-ligand pairs as positive controls

How can I evaluate the specificity and sensitivity of experimental techniques for studying Olfr508?

To ensure reliable results when studying Olfr508:

  • Include appropriate controls:

    • Positive controls: Test known OR-ligand pairs (such as Olfr690-isovaleric acid, Olfr961-eugenol)

    • Negative controls: Test ORs with non-activating odorants

  • Quantify response parameters:

    • For in situ methods, quantify staining intensity as done for known OR-odorant pairs

    • For functional assays, measure both amplitude and kinetics of responses

  • Validate across techniques:

    • Compare results from multiple methodological approaches

    • For example, validate in vitro findings in native OSNs

  • Apply statistical rigor:

    • Ensure research questions are "specific, complex, and empirically verifiable"

    • Use appropriate statistical tests to determine significance of results

What are the major unresolved questions regarding Olfr508 function and expression?

Several research gaps exist in our understanding of olfactory receptors that likely apply to Olfr508:

  • Complete molecular receptive range (MRR):

    • The full spectrum of agonists and antagonists remains to be identified

    • Understanding the chemical features that determine ligand specificity

  • Structure-function relationships:

    • The specific binding sites and conformational changes associated with activation

    • How structural variations influence ligand selectivity

  • Signaling dynamics:

    • Temporal aspects of receptor activation, adaptation, and desensitization

    • Integration of signals at the cellular level

  • Developmental regulation:

    • Factors controlling the expression and maturation of Olfr508 in OSNs

    • Zonal expression patterns and their functional significance

How can advanced technologies be applied to address current limitations in Olfr508 research?

Several emerging technologies offer promising approaches:

  • CRISPR-Cas9 gene editing:

    • Generation of tagged Olfr508 lines for easier detection and visualization

    • Creation of knockout models to study function through loss-of-function approach

  • Single-cell RNA sequencing:

    • Profiling of Olfr508-expressing neurons to understand co-expressed genes

    • Identification of signaling components that modulate receptor function

  • Cryo-EM and computational modeling:

    • Structural characterization of Olfr508 in different conformational states

    • In silico screening of potential ligands based on structural models

  • Optogenetics and chemogenetics:

    • Controlled activation of Olfr508-expressing neurons

    • Studying the contribution of Olfr508 to olfactory perception

What collaborative research approaches might accelerate progress in understanding Olfr508?

Progress in understanding Olfr508 would benefit from:

  • Interdisciplinary collaborations:

    • Combining expertise in molecular biology, neuroscience, and chemistry

    • Integrating computational approaches with experimental validation

  • Standardized research frameworks:

    • Development of consistent methodologies for OR characterization

    • Creation of shared databases of OR-ligand interactions

  • Translation between in vitro and in vivo systems:

    • Systematic comparison of results across different experimental paradigms

    • Identification of factors that account for discrepancies between systems

  • Integration of findings across species:

    • Comparative studies of orthologous receptors in different mammalian species

    • Understanding evolutionary conservation and divergence in OR function

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.