Recombinant Mouse Olfactory receptor 867 (Olfr867)

Shipped with Ice Packs
In Stock

Description

Functional Insights

Role in olfaction:

  • Olfr867 is part of the mouse olfactory receptor family, which detects volatile odorants through combinatorial coding .

  • Like other olfactory receptors, it couples with Gα<sub>olf</sub> proteins to activate adenylate cyclase, triggering cAMP-mediated signal transduction .

Ligand specificity:
While direct ligands for Olfr867 remain uncharacterized, related receptors exhibit sensitivity to aldehydes, ketones, and aromatic compounds . Functional assays using heterologous systems (e.g., HEK293 cells) are standard for deorphanization .

Research Applications

Key uses in studies:

ApplicationMethodRelevance
Ligand screeningCalcium imaging / cAMP assaysIdentifies odorants activating Olfr867
Gene regulation studiesRNA-seq / qRT-PCRQuantifies Olfr867 expression changes under odorant exposure
Structural biologyCryo-EM / X-ray crystallographyResolves receptor-ligand binding mechanisms (theoretical application)

Challenges and Future Directions

  • Heterologous expression: Low yields and improper folding in non-native systems remain barriers .

  • Functional redundancy: Olfr867 may overlap in ligand specificity with other receptors (e.g., Olfr538, Olfr524) .

  • In vivo validation: Conditional knockout models are needed to define its role in odor-guided behaviors .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order remarks, and we will accommodate your request.
Lead Time
Delivery time may vary based on the purchasing method and location. For precise delivery time, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to concentrate the contents. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by factors including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Olfr867; Olfactory receptor 867
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-331
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Olfr867
Target Protein Sequence
MEIENHTLITKFLILGLSDDPELQPILFGLFLSMYLVTLLGNLLIILAVSSDSHLHKPMY FLLSNLSFIDICFISTTIPKMLVNMQSQIKDISYIECLTQVFFFNIFAGMDNFLLTLMAY DRFVAICHPLNYTVIMNPRLCALLILMFWIIMFWVSLIHVLLMNELNFSRGTEIPHFFCE LAQVLKVSNSDNHVNNVFMYVVTSLLGVIPMTGILMSYSQIFSSLFRMSSTVSKYKAFST CGSHLCVVTLFYGSGFGVYFSSSVVHSTQRRKVASLMYTVISPMLNPFIYTLRNKDVKGA LGKLFNRVASSPSCINDIRNKLLLRSVRQIL
Uniprot No.

Target Background

Function
Potentially functions as an olfactory or taste receptor.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are most effective for producing Recombinant Mouse Olfr867?

Recombinant Olfactory receptor 867 (Olr867) can be expressed and purified from various host systems, with each offering distinct advantages. E. coli and yeast expression systems provide the highest yields and significantly shorter turnaround times, making them preferable for initial studies or when large quantities are needed . For applications requiring post-translational modifications that facilitate proper protein folding or activity retention, insect cells with baculovirus expression systems or mammalian cell expression systems are recommended .

When selecting an expression system, researchers should consider:

  • Required protein yield

  • Need for post-translational modifications

  • Equipment and expertise available

  • Timeline constraints

  • Downstream applications

For functional studies requiring properly folded protein with native activity, mammalian expression systems may provide superior results despite lower yields.

What purification strategy yields the highest purity Olfr867 for structural studies?

A multi-step purification protocol is recommended for obtaining highly pure Olfr867 suitable for structural studies:

  • Initial capture using affinity chromatography (if expressed with appropriate tag)

  • Intermediate purification via ion exchange chromatography

  • Polishing step using size exclusion chromatography

The purity should be assessed via reducing and non-reducing SDS-PAGE, with acceptance criteria of ≥95% purity . Endotoxin levels should be verified using Kinetic LAL method with acceptance criteria of ≤0.1 EU/μg .

How does the structure of Olfr867 compare with other characterized olfactory receptors?

While direct structural comparison data for Olfr867 is limited in the provided search results, general principles of olfactory receptor structure can guide comparative analysis. Olfactory receptors share the characteristic seven-transmembrane GPCR architecture but differ in their ligand-binding domains, which confer odor specificity.

Comparative sequence analysis with well-characterized receptors such as MOR42-3 can provide insights into potential ligand binding sites . Researchers investigating structural relationships should consider:

  • Sequence alignment of transmembrane domains

  • Conservation of potential ligand-binding residues

  • Homology modeling using known GPCR structures as templates

  • Molecular dynamics simulations to predict conformational changes upon ligand binding

What experimental approaches can be used to identify potential ligands for Olfr867?

A multi-faceted approach combining in silico and in vitro methods is recommended for identifying Olfr867 ligands:

In silico screening approach:

  • Develop a homology model of Olfr867 based on known GPCR structures

  • Create a virtual library of potential odorants with diverse structures

  • Perform molecular docking simulations using software such as Internal Coordinate Mechanics (ICM)

  • Apply multiple scoring functions to evaluate receptor-ligand interactions

  • Select top-scoring compounds for experimental validation

In vitro validation methods:

  • Heterologous expression in Xenopus oocytes

  • Two-electrode voltage clamp electrophysiology to measure receptor activation

  • Screen for both agonist and antagonist activity

  • Dose-response analysis to determine potency and efficacy

This combined approach has demonstrated high positive predictive value in identifying novel ligands for other olfactory receptors such as MOR42-3 .

What are the challenges in differentiating between agonist and antagonist activity for Olfr867?

Distinguishing between agonists and antagonists for olfactory receptors presents several methodological challenges:

  • Baseline activity determination: Establishing reliable baseline activity of the receptor is crucial for detecting both activation and inhibition

  • Concentration-dependent effects: Some compounds may act as partial agonists at low concentrations but antagonists at higher concentrations

  • Experimental design complexity: Antagonist screening requires pre-incubation with the test compound followed by challenge with a known agonist

  • Low potency antagonists: Some antagonists may have low potency, requiring careful dose-response analysis

A systematic approach using electrophysiology in Xenopus oocytes can help characterize compounds as agonists or antagonists by measuring current responses to individual compounds and in competition assays with known ligands .

How can researchers track Olfr867-expressing neurons and their axonal projections?

Several complementary techniques can be employed to visualize Olfr867-expressing neurons and their projections:

  • In situ hybridization: Using Olfr867-specific probes to identify neurons expressing the receptor mRNA

  • Immunohistochemistry: Developing or utilizing antibodies against Olfr867, similar to approaches used for mOR256-17

  • Genetic labeling: Creating transgenic mouse lines with fluorescent proteins expressed under the Olfr867 promoter

  • Axon tracing: Applying lipophilic dyes to specific glomeruli and tracing back to olfactory sensory neurons

These approaches can reveal:

  • The number and distribution of Olfr867-expressing neurons in the olfactory epithelium

  • The targeting patterns of Olfr867-expressing axons

  • The location and number of glomeruli formed by Olfr867-expressing neurons

  • Whether axons correctly converge onto specific glomeruli

How is Olfr867 expression affected in mouse models with olfactory development defects?

While specific data on Olfr867 in developmental models is not provided in the search results, insights can be drawn from studies of other olfactory receptors in β3GnT2-deficient mice. In these mice:

  • Nearly one-quarter of all odorant receptor genes are down-regulated

  • Expression changes vary significantly between different receptors:

    • Some receptors show increased expression (up to 60% more neurons)

    • Others show decreased expression (up to 75% fewer neurons)

  • Axon guidance is often disrupted, with axons tracking to inappropriate targets

  • Some glomeruli become populated by axons expressing more than one odorant receptor

To study Olfr867 in developmental models, researchers should consider:

  • Quantitative PCR to measure expression levels

  • In situ hybridization to count Olfr867-expressing neurons

  • Immunohistochemistry to track axon trajectories

  • Functional assays to assess odor-evoked activity

How can in silico screening be optimized for Olfr867 ligand discovery?

To optimize in silico screening for Olfr867 ligand discovery, researchers should consider:

Model development:

  • Generate multiple homology models based on different GPCR templates

  • Refine models using molecular dynamics simulations

  • Validate models using known ligands if available

Virtual compound library:

  • Create a diverse library with representatives from multiple chemical classes

  • Include compounds with various functional groups: aldehydes, phenyls, alkenes, esters, and ethers

  • Calculate molecular descriptors for each compound (optimally the 18-32 most salient descriptors)

Docking and scoring:

  • Apply multiple scoring functions to reduce false positives

  • Use both standard scoring and molecular force field scoring approaches

  • Consider receptor flexibility during docking simulations

  • Evaluate the top-scoring compounds from each scoring method

This approach can significantly enhance the efficiency of ligand discovery, as demonstrated by the successful identification of 19 agonists and 3 antagonists for MOR42-3 using similar methods .

What methodological approaches can be used to study the molecular receptive range of Olfr867?

Understanding the molecular receptive range of Olfr867 requires systematic investigation of its response profile to diverse odorants:

Experimental approaches:

  • High-throughput screening: Test Olfr867 against large odorant libraries using calcium imaging or reporter assays

  • Structure-activity relationship analysis: Test series of structurally related compounds to identify key molecular features required for receptor activation

  • Electrophysiological characterization: Detailed dose-response analysis of candidate ligands using Xenopus oocyte expression system

  • Competitive binding assays: Evaluate interactions between different ligands at the receptor binding site

Data analysis methods:

  • Correlate receptor responses with molecular descriptors of odorants

  • Identify the most salient descriptors that explain variance in receptor responses

  • Generate multidimensional odor maps to visualize the receptor's molecular receptive range

  • Apply machine learning approaches to predict additional potential ligands

This comprehensive approach can determine whether Olfr867 is broadly or narrowly tuned and identify the chemical features most important for ligand recognition .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.