Recombinant Mouse Olfactory receptor 8 (Olfr8)

Shipped with Ice Packs
In Stock

Description

Functional and Pathway Associations

Olfr8 participates in olfactory transduction and interacts with downstream signaling components:

Key Functional Roles

  • G-protein coupled receptor activity: Mediates cAMP signaling upon odorant binding .

  • Signal transduction: Couples with Gα<sub>olf</sub> proteins to activate adenylate cyclase .

Associated Pathways

PathwayRelated Proteins
Olfactory transductionCALML3, OR10C1, OLFR494, OLFR497, OR6Q1
GPCR signalingMAS1, Fzd4, GPR37B, TAS2R140

Genetic and Expression Insights

  • Chromosomal Location: Chr9:37808020-37814815 (mouse genome) .

  • Transcript Variants: Predominantly expressed as a single isoform in olfactory epithelium .

  • Expression Specificity: Detected in mature olfactory sensory neurons but absent in non-chemosensory tissues .

Limitations and Research Gaps

While recombinant Olfr8 is widely used for in vitro studies, key challenges remain:

  1. Ligand specificity: No experimentally validated odorants have been reported for Olfr8 in peer-reviewed studies .

  2. Structural data: No crystal or cryo-EM structures are available as of 2025.

  3. In vivo functional studies: Knockout mouse models for Olfr8 have not been characterized in published literature .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Olfr8; Olfactory receptor 8; Odorant receptor M64
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-310
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Olfr8
Target Protein Sequence
MESGNSTRRIPSFFLLGFSENPHLQFLIFVLFLSMYLVTVLGNLLIIMVIITQSPLHTPM YFFLANLSFVDICFTSTTVPKMLVNIQTQSKAITYADCISQMSVFLVFAELDNFLLAVMA YDRYVAICHPLYYTFIVNQHLCILMVLLSWVVSILHAFLQSSIVLQLTFCGDVKIPHFFC ELNQLSQLTCLDSLSSHLIMNLVPVLLAVISFSSILYSYFKIVSSICSISSVQGKYTAFS TCVSHLSIVFLFYSTGLGVYVSSAVVQSSHSAARASVMYTVVTPMLNPFIYSLRNKDVKK ALERLLEGKL
Uniprot No.

Target Background

Function
Odorant receptor.
Database Links
Protein Families
G-protein coupled receptor 1 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Olfactory Receptor 8 (Olfr8) and why is it significant for research?

Olfactory receptors (ORs) constitute the largest family of sensory membrane proteins in mammals and play a crucial role in recognizing and discriminating diverse odorous molecules within the olfactory system. Olfr8 is one of these receptors in the mouse genome that researchers study to better understand olfactory signal detection and transduction mechanisms. The significance of studying Olfr8 lies in understanding the molecular basis of odor detection, which has implications for sensory neurobiology and potential applications in biomedical research .

What challenges exist in the recombinant expression of olfactory receptors like Olfr8?

Recombinant expression of olfactory receptors presents significant challenges due to difficulties in achieving functional expression in high yields. These difficulties have historically prevented structural and biophysical studies at the protein level. The primary challenges include poor trafficking to the plasma membrane, protein misfolding, and low expression levels when using conventional expression systems. For successful expression of ORs like Olfr8, researchers must optimize expression vectors, cell types, and culture conditions to improve protein yield while maintaining functionality .

What expression systems are commonly used for recombinant mouse olfactory receptors?

Mammalian cell lines are the most commonly used expression systems for recombinant mouse olfactory receptors. Successful expression has been achieved in cell lines such as HEK293T cells, which can yield approximately 10^6 OR molecules per cell when properly optimized. Other expression systems include insect cells (Sf9) and specialized mammalian cell lines with enhanced protein folding capabilities. The expression system choice depends on the specific research goals, whether structural studies, functional characterization, or screening for ligands .

How can the expression of recombinant olfactory receptors be monitored and quantified?

Quantification and monitoring of olfactory receptor expression can be accomplished using various fluorescent probes and tags. One effective approach involves dual-color labeling: fusing green fluorescent protein (GFP) to the C-terminus of the receptor to measure total cellular OR biosynthesis, while adding a short polypeptide tag (12 amino acids) to the N-terminus allows selective visualization of receptors at the plasma membrane through post-translational fluorescence labeling. Flow cytometry can then be used to quantify expression levels accurately. This dual approach helps distinguish between total protein expression and functional receptors properly localized to the cell membrane .

How does the adaptation of olfactory receptor expression correlate with environmental odor statistics?

Research indicates that olfactory receptor expression levels adapt according to environmental odor statistics to maximize information transfer to the brain through an efficient coding mechanism. This adaptation follows a pattern where receptors with intermediate abundance levels show the most significant and reproducible changes in response to environmental shifts. The relationship between receptor numbers and the statistics of the odor environment involves a complex interplay that depends on the full correlation structure of inputs, making these adaptations context-dependent. This means that changes in the expression of a specific receptor type depend on the global context of responses from all other receptors .

What methodological approaches can overcome low expression yields of Olfr8 in recombinant systems?

To overcome low expression yields of olfactory receptors like Olfr8, researchers can employ several methodological approaches:

  • Codon optimization: Adjusting the codon usage to match the expression host

  • Addition of trafficking enhancers: Including sequences that promote proper folding and surface expression

  • Fusion partners: Using fusion proteins known to enhance membrane protein expression

  • Optimized signal sequences: Implementing signal peptides that improve membrane targeting

  • Chaperone co-expression: Co-expressing molecular chaperones to assist protein folding

These approaches have enabled researchers to achieve expression levels of up to 10^6 receptors per cell in transient transfection systems, which is sufficient for many functional and structural studies .

What computational models explain the distribution and adaptation of olfactory receptors in the epithelium?

Mathematical models based on efficient coding principles have been developed to explain the non-uniform distribution of olfactory receptor types in the olfactory epithelium. These models propose that receptor abundances adapt to natural odor statistics to maximize information transmitted to the brain.

The dynamic model for changing receptor numbers can be represented by the equation:

dNidt=αNi(1jNjNmax)βNiσi2j(C1)ijNjσj2\frac{d N_i}{dt} = \alpha N_i \left(1 - \frac{\sum_j N_j}{N_{\text{max}}}\right) - \beta \frac{N_i}{σ_i^2} \sum_j (C^{-1})_{ij} \frac{N_j}{σ_j^2}

Where:

  • NiN_i is the number of neurons expressing receptor type i

  • αα is the birth rate

  • ββ is a scaling factor

  • σi2σ_i^2 is the noise variance for receptor type i

  • CC is the covariance matrix of glomerular responses

This model predicts that narrowly tuned receptors are more readily affected by changes in odor statistics than broadly tuned ones, and that environments differing in odor identity create greater deviations in optimal receptor distribution than environments differing only in odor frequency .

How can receptor-ligand interactions be determined for recombinant olfactory receptors?

Determining receptor-ligand interactions for recombinant olfactory receptors involves screening large odorant compound libraries to discover selective agonists. Methodologically, this requires:

  • Functional expression: Establishing a cell line with stable expression of the olfactory receptor

  • Reporter systems: Implementing calcium imaging, cAMP assays, or other second messenger readouts

  • High-throughput screening: Systematic testing of compound libraries

  • Dose-response analysis: Determining EC50 values for potent agonists

  • Structure-activity relationship studies: Comparing chemical structures of active compounds

This approach has successfully identified selective agonists for recombinant olfactory receptors, including mOR256-17, providing essential tools for probing receptor function in future scaled-up productions .

What are the key components of an optimized protocol for Olfr8 recombinant expression?

An optimized protocol for recombinant expression of Olfr8 should include:

Protocol ComponentSpecificationRationale
Expression VectorpCMV with Kozak sequenceEnhances translation initiation
N-terminal TagRhodopsin-derived sequence (20 aa)Improves trafficking to membrane
C-terminal TagGFP or His-tag (6xHis)Facilitates detection and purification
Host Cell LineHEK293T or HEK293S GnTI-Mammalian glycosylation patterns
Culture MediumDMEM with low IgG FBS (5-10%)Reduces background in functional assays
Transfection MethodLipid-based (e.g., Lipofectamine)High efficiency for membrane proteins
Expression Temperature30-32°C post-transfectionSlows expression to improve folding
Expression Duration48-72 hoursOptimal balance of yield vs. toxicity
AdditivesSodium butyrate (5-10 mM)Enhances protein expression levels

This protocol builds on successful approaches used for other olfactory receptors and can be further optimized based on specific experimental needs .

How should experimental controls be designed for Olfr8 functional characterization studies?

Proper experimental controls are critical for reliable functional characterization of Olfr8. A comprehensive control strategy should include:

  • Negative expression controls: Cells transfected with empty vector to establish baseline responses

  • Positive functional controls: Cells expressing a well-characterized OR with known ligands

  • Mock transfection controls: To account for transfection reagent effects

  • Receptor specificity controls: Testing Olfr8 against ligands known to activate other ORs

  • Dose-response validations: Serial dilutions of putative ligands to establish EC50 values

  • Antagonist verification: Testing whether responses can be blocked by known OR antagonists

  • Signaling pathway controls: Using forskolin to directly activate adenylyl cyclase as a positive control for cAMP-dependent assays

These controls ensure that observed responses are specific to Olfr8 activation rather than artifacts of the expression system or assay conditions .

What strategies can address variability in recombinant olfactory receptor studies?

Variability in recombinant olfactory receptor studies presents a significant challenge. Strategies to address this include:

  • Standardized cell cultivation: Maintaining consistent passage numbers and confluence levels

  • Inducible expression systems: Using tetracycline-inducible promoters to control expression timing and levels

  • Single cell analysis: Employing flow cytometry to correlate receptor expression with functional responses

  • Internal normalization: Including reference compounds in each experimental set

  • Multiplexed assays: Running multiple receptors in parallel to identify batch effects

  • Automated liquid handling: Reducing pipetting errors in high-throughput screens

  • Data normalization protocols: Establishing consistent methods to normalize raw data across experiments

  • Biological replicates: Performing experiments across multiple independent transfections and cell passages

Implementation of these strategies can significantly reduce experimental variability and improve reproducibility of results when working with recombinant olfactory receptors .

How can researchers distinguish between specific and non-specific responses in Olfr8 functional assays?

Distinguishing specific from non-specific responses requires rigorous analytical approaches:

  • Statistical thresholding: Establishing response thresholds at least 3 standard deviations above mock-transfected controls

  • Dose-dependency analysis: Confirming that responses follow expected concentration-dependent patterns

  • Receptor expression correlation: Verifying that response magnitude correlates with receptor expression levels

  • Pharmacological profiling: Testing structure-activity relationships of related compounds

  • Competitive binding assays: Demonstrating that known ligands compete for receptor binding

  • Receptor mutagenesis: Confirming that point mutations in binding domains alter response profiles

  • Cross-receptor activity mapping: Testing ligands against a panel of related receptors to establish specificity patterns

These approaches collectively provide confidence that observed responses represent genuine receptor-ligand interactions rather than artifacts or non-specific effects .

What mathematical frameworks best represent the adaptation dynamics of olfactory receptor expression?

The adaptation dynamics of olfactory receptor expression can be represented by mathematical frameworks based on information theory and efficient coding principles. The gradient ascent algorithm, modified to account for biological constraints, provides a robust representation:

dNidt=αNi(1jNjNmax)βNiσi2j(C1)ijNjσj2\frac{d N_i}{dt} = \alpha N_i \left(1 - \frac{\sum_j N_j}{N_{\text{max}}}\right) - \beta \frac{N_i}{σ_i^2} \sum_j (C^{-1})_{ij} \frac{N_j}{σ_j^2}

This equation captures the key aspects of receptor adaptation, where:

  • The first term represents logistic growth leading to population saturation at NmaxN_{\text{max}}

  • The second term represents an experience-dependent modification of death rates based on olfactory input statistics

  • The covariance matrix CC captures correlations between receptor responses to odors in the environment

Simulation studies using this framework show that receptor populations converge to optimal distributions over time, with convergence rates varying based on initial conditions and receptor type .

How should contradictory data regarding Olfr8 ligand specificity be reconciled?

When faced with contradictory data regarding ligand specificity, researchers should apply a systematic reconciliation approach:

  • Methodological comparison: Evaluate differences in expression systems, functional assays, and detection methods

  • Receptor construct analysis: Compare sequence variations in the receptor constructs used across studies

  • Concentration range assessment: Determine whether studies tested overlapping concentration ranges

  • Data normalization review: Examine how raw data was processed and normalized in each study

  • Statistical reanalysis: Apply consistent statistical methods across datasets

  • Independent verification: Test key ligands in a standardized system with appropriate controls

  • Meta-analysis: Combine data across studies using weighted approaches based on methodological rigor

  • Computational modeling: Develop binding models that might explain apparent contradictions

Through this process, researchers can often identify the source of contradictions and develop a unified understanding of receptor specificity .

How can systems biology approaches integrate Olfr8 research into broader olfactory models?

Systems biology approaches offer powerful frameworks for integrating Olfr8 research into comprehensive olfactory models through:

  • Network modeling: Mapping interactions between olfactory receptors, signal transduction components, and neural circuits

  • Multi-omics integration: Combining transcriptomics, proteomics, and metabolomics data to understand system-level regulation

  • Dynamical systems analysis: Modeling temporal aspects of olfactory processing from receptor binding to perception

  • Information-theoretic frameworks: Quantifying information flow through the olfactory system from receptors to higher brain regions

  • Comparative genomics: Analyzing evolutionary conservation and divergence of olfactory receptor families across species

These approaches can place specific findings about Olfr8 into broader contexts of olfactory processing, enabling predictions about system behavior under various conditions and revealing emergent properties not apparent from studies of individual components .

What advances in structural biology could facilitate Olfr8 research?

Recent advances in structural biology that could facilitate Olfr8 research include:

  • Cryo-electron microscopy: Enabling structural determination of membrane proteins without crystallization

  • Computational structure prediction: Tools like AlphaFold that can predict protein structures with increasing accuracy

  • Native mass spectrometry: Analyzing protein complexes in their native state to understand interaction partners

  • Hydrogen-deuterium exchange mass spectrometry: Probing dynamic aspects of receptor conformation during ligand binding

  • Solid-state NMR spectroscopy: Providing atomic-level insights into membrane protein structure in lipid environments

  • Nanobody-assisted crystallography: Using camelid antibody fragments to stabilize receptors for crystallization

  • Time-resolved structural methods: Capturing conformational changes during receptor activation

These technological advances could overcome the historical barriers to structural studies of olfactory receptors, providing crucial insights into binding mechanisms and receptor dynamics .

How might CRISPR-Cas9 technology be applied to study Olfr8 function in vivo?

CRISPR-Cas9 technology offers transformative approaches for studying Olfr8 function in vivo through:

  • Targeted gene editing: Creating precise mutations in Olfr8 to study structure-function relationships

  • Knock-in reporter systems: Introducing fluorescent tags to visualize Olfr8 expression patterns

  • Conditional expression systems: Implementing inducible Olfr8 expression to study temporal aspects

  • Cell-type specific modifications: Restricting Olfr8 modifications to specific olfactory sensory neuron populations

  • CRISPRi/CRISPRa approaches: Modulating Olfr8 expression levels without altering sequence

  • Base editing: Introducing specific amino acid changes to probe binding site residues

  • Lineage tracing: Tracking the development and targeting of Olfr8-expressing neurons

These applications could overcome limitations of traditional transgenic approaches, enabling more precise manipulations of the olfactory system to understand Olfr8's role in odor detection and processing .

What are the most significant recent advances in recombinant olfactory receptor research?

Recent significant advances in recombinant olfactory receptor research include improved expression systems yielding up to 10^6 receptors per cell, dual-color labeling techniques for quantifying membrane localization, and the development of mathematical models explaining receptor abundance adaptation. These advances have enabled more sophisticated functional characterization studies and begun to overcome the historical barriers to structural and biophysical studies of these challenging membrane proteins. Additionally, the discovery of selective agonists for specific receptors has provided essential tools for probing receptor function and understanding signaling mechanisms .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.