Recombinant Mouse Olfactory receptor Olfr180 (Olfr180)

What is Olfr180 and how is it classified within the olfactory receptor family?

Olfr180 is a G-protein-coupled receptor (GPCR) belonging to the extensive family of olfactory receptors in mice. It functions as a chemosensory receptor that detects odorant molecules and initiates signal transduction in olfactory sensory neurons. Olfactory receptors in mice are encoded by approximately 1700 genes and pseudogenes collectively comprising both olfactory receptors (ORs) and vomeronasal receptors (VRs) . Olfr180 specifically belongs to the OR subfamily, which can be phylogenetically categorized into two classes: Class I receptors that have counterparts throughout the vertebrate lineage, and Class II receptors that are specific to tetrapods . This classification provides important evolutionary context for understanding the receptor's biological functions and ligand specificity profiles.

Olfr180 is characterized by its full-length sequence spanning 317 amino acids and has been assigned the UniProt ID Q7TS48 . The complete amino acid sequence of mouse Olfr180 is: MEKTNHSLTTQFILVGFSDHPDLKTPLFLLFSVIYLVTMVGNLGLVAVIYLEPRLHTPMYIFLGNLALMDSCCSCAITPKILENFFSVDRRISLYECMAQFYFLCLAETADCFLLAAMAYDRYVAICNPLQYHSMMSKKLSIQMSIGTFITSNLHSLIHVGCLLRLTFCKSNRIDHFFCDILPLYRLSCTDPFINELMIYIFSMPIQVFTITTVLVSYFCILLTIFKMKSKDGRGKAFSTCASHFFSVSIFYVCLLMYIRPFDEGNKDIPVAVFYTIIIPLLNPFIYSLRNKEVVNAVKKVMKTHSIFKNASASMAR . This sequence information is crucial for designing expression constructs, developing antibodies, and conducting structure-function analyses.

How does the expression pattern of Olfr180 compare to other olfactory receptors in mouse tissues?

The expression pattern of Olfr180, like other olfactory receptors, follows the "one neuron-one receptor" rule, where each mature olfactory sensory neuron (OSN) expresses only one allele of a single OR gene . This monogenic expression is a fundamental principle in olfactory coding that enables discrimination between different odors. Research using deep RNA sequencing, expression microarrays, and quantitative RT-PCR has demonstrated that OR genes, including Olfr180, are not equally or randomly expressed but show reproducible distribution patterns of abundance in olfactory tissues .

When examining expression levels, studies have revealed significant variations among different olfactory receptors. While the search results don't provide specific expression data for Olfr180 compared to other receptors, research has established that microarray approaches have confirmed preferential expression of RNA encoding receptors such as MOR23-1, MOR31-4, MOR32-11, and MOR40-4 in the mouse olfactory epithelium (OE) . Similar methodologies can be applied to quantify Olfr180 expression. Additionally, recent research has shown unexpected expression of olfactory signaling genes in non-olfactory tissues, with some olfactory receptors detected in ocular tissues including the corneal epithelium, suggesting potential chemosensory functions beyond the canonical olfactory system .

What is the molecular structure of Olfr180 and how does it influence ligand binding?

Olfr180, like other olfactory receptors, possesses the characteristic seven-transmembrane domain structure typical of G-protein-coupled receptors (GPCRs). While the crystal structure of Olfr180 has not been specifically detailed in the provided search results, the receptor's functional properties can be inferred from its amino acid sequence and from studies of similar olfactory receptors. The full amino acid sequence of Olfr180 (317 amino acids) contains regions that form the transmembrane domains and the binding pocket for odorant molecules .

Studies of related olfactory receptors provide insight into how the structure influences ligand binding. Research has demonstrated that even relatively unrelated olfactory receptors can have overlapping molecular receptive ranges while maintaining unique response profiles . For example, receptors MOR23-1, MOR31-4, MOR32-11, and MOR40-4 all respond to carboxylic acids in the 7-10 carbon range, yet each possesses a distinct receptive profile . This suggests that specific amino acid residues within the binding pocket create a unique three-dimensional environment that determines ligand specificity. The structure-function relationship is critical for understanding how subtle differences in receptor architecture translate to the ability to discriminate between closely related odorant compounds, allowing a finite number of receptors to detect an almost unlimited variety of odors through combinatorial coding.

What are the optimal expression systems for producing functional recombinant Olfr180?

For functional studies requiring properly folded receptors with native-like activity, heterologous expression in Xenopus oocytes provides a valuable alternative. This system has been effectively used for electrophysiological characterization of mouse olfactory receptors similar to Olfr180 . The Xenopus oocyte system allows co-expression with Gαolf and the cystic fibrosis transmembrane regulator, enabling electrophysiological assays of receptor responses to potential ligands . To enhance expression efficiency in such systems, the "rhodopsin-tag" strategy (adding the N-terminal 20 amino acid residues of human rhodopsin) has proven effective for several mouse olfactory receptors and could be applied to Olfr180 . Mammalian cell lines such as HEK293 cells represent another viable option, particularly for studies requiring mammalian post-translational modifications and trafficking machinery.

What purification strategies yield the highest purity and stability for recombinant Olfr180?

Purification of recombinant Olfr180 requires carefully optimized protocols to maintain protein stability and functionality. For His-tagged Olfr180 expressed in E. coli, affinity chromatography using nickel or cobalt resins provides an effective initial purification step . The purification protocol should be performed under conditions that minimize protein denaturation, potentially using mild detergents to solubilize the membrane-associated receptor. As reported, recombinant Olfr180 can be purified to greater than 90% homogeneity as determined by SDS-PAGE analysis .

Following affinity purification, size exclusion chromatography can further enhance purity by separating the target protein from aggregates and contaminants based on molecular size. For long-term storage, lyophilization has been successfully employed for recombinant Olfr180 . The lyophilized powder should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, and the addition of glycerol (5-50% final concentration) is recommended for aliquoting and long-term storage at -20°C/-80°C . To maintain stability, repeated freeze-thaw cycles should be avoided, and working aliquots can be stored at 4°C for up to one week . The storage buffer composition (Tris/PBS-based buffer, 6% Trehalose, pH 8.0) has been optimized to enhance protein stability during storage .

How can researchers optimize the reconstitution of lyophilized Olfr180 for functional studies?

Proper reconstitution of lyophilized Olfr180 is crucial for maintaining its functional integrity in subsequent experiments. The recommended protocol begins with brief centrifugation of the vial prior to opening to bring the contents to the bottom, minimizing potential product loss . The lyophilized protein should then be reconstituted in deionized sterile water to achieve a concentration between 0.1-1.0 mg/mL . This concentration range balances the need for sufficient protein quantities for experimental use while avoiding potential aggregation issues that can occur at higher concentrations.

For optimal stability during storage, the addition of glycerol is strongly recommended. A final glycerol concentration of 5-50% (with 50% being the default recommendation) helps prevent freeze-induced denaturation and maintains protein conformation during freeze-thaw cycles . After reconstitution and glycerol addition, the solution should be aliquoted into smaller volumes to minimize the need for repeated freeze-thaw cycles, which can significantly compromise protein integrity. Storage temperature is another critical factor, with -20°C/-80°C recommended for long-term storage and 4°C suitable for working aliquots that will be used within one week . Before using the reconstituted protein in functional assays, it may be beneficial to perform a quality control assessment using techniques such as circular dichroism or limited proteolysis to confirm proper folding and stability of the receptor.

What methods are most effective for determining the ligand specificity of Olfr180?

Determining the ligand specificity of olfactory receptors like Olfr180 requires specialized techniques that can detect receptor activation in response to potential odorant compounds. Electrophysiological recording using the Xenopus oocyte expression system represents one of the most direct and sensitive approaches . In this method, Olfr180 would be co-expressed with Gαolf and the cystic fibrosis transmembrane regulator in Xenopus oocytes, allowing measurement of receptor-activated currents in response to different odorants . This approach has been successfully employed for characterizing the molecular receptive ranges of multiple mouse olfactory receptors including MOR23-1, MOR31-4, MOR32-11, and MOR40-4, which respond to carboxylic acids in the 7-10 carbon range .

Calcium imaging provides another powerful technique for analyzing Olfr180 activation. This method utilizes fluorescent calcium indicators to visualize intracellular calcium flux following receptor activation in heterologous expression systems or in native olfactory sensory neurons. For more high-throughput screening, cAMP assays can measure the accumulation of second messengers produced when the receptor couples to Gαolf and activates adenylyl cyclase. Based on studies with related receptors, initial ligand screening for Olfr180 should include carboxylic acids with carbon chain lengths of 7-10, as these have been identified as activators of several mouse olfactory receptors . The resulting data can be compiled into a comprehensive table of ligand responses to establish the molecular receptive range of Olfr180 and identify its preferred ligands.

How can researchers accurately measure Olfr180 expression levels in different tissues?

Accurate quantification of Olfr180 expression across different tissues requires sensitive and specific molecular techniques. Quantitative real-time PCR (qRT-PCR) represents a gold standard approach for measuring mRNA expression levels . This method requires careful primer design to ensure specificity for Olfr180, particularly given the high sequence similarity among olfactory receptor genes. Ideally, primers should span intron-exon boundaries to minimize amplification from contaminating genomic DNA . The following table outlines key considerations for qRT-PCR analysis of Olfr180:

For spatial localization of Olfr180 expression, in situ hybridization techniques such as RNAscope provide high sensitivity and specificity . This approach allows visualization of Olfr180 mRNA within tissue sections, revealing cell-specific expression patterns. The protocol typically involves tissue fixation, sectioning, probe hybridization, and signal amplification steps . For protein-level detection, immunohistochemistry or western blotting with antibodies specific to Olfr180 can be employed, though the availability of specific antibodies for individual olfactory receptors often presents a challenge due to the high sequence similarity within this protein family.

What are the optimal conditions for studying Olfr180 signaling pathways in vitro?

Investigating Olfr180 signaling pathways requires careful consideration of the experimental system to ensure physiologically relevant results. For in vitro studies, heterologous expression systems that recapitulate the native signaling environment are preferred. The Xenopus oocyte system has proven effective for functional characterization of olfactory receptors when co-expressed with Gαolf and the cystic fibrosis transmembrane regulator . This system allows direct electrophysiological measurement of receptor activation but may not fully replicate all aspects of the mammalian signaling cascade.

Mammalian cell lines such as HEK293 or Hana3A cells (a modified HEK293 cell line) provide a more native-like environment for studying Olfr180 signaling. These systems should be supplemented with key signaling components including:

• Gαolf - the G-protein alpha subunit that couples specifically to olfactory receptors

• Receptor trafficking proteins (e.g., RTP1, RTP2, REEP1) to enhance surface expression

• Golf/adenylyl cyclase III for downstream signal amplification

• Olfactory-specific kinases and phosphatases that regulate receptor activity

For enhancing receptor expression, the use of N-terminal fusion tags such as the first 20 amino acids of rhodopsin (the "rhodopsin tag") has been demonstrated to improve surface expression of olfactory receptors in heterologous systems . When designing experiments to study Olfr180 signaling, it's important to consider the temporal dynamics of the response. Calcium imaging or FRET-based cAMP sensors can provide real-time visualization of signaling events following receptor activation, allowing for detailed characterization of signal onset, amplitude, and desensitization kinetics under various experimental conditions.

How can Olfr180 be utilized in structure-function relationship studies of olfactory receptors?

Olfr180 provides an excellent model for investigating structure-function relationships in olfactory receptors due to its well-characterized sequence and potential for comparative analysis with related receptors. Site-directed mutagenesis represents a powerful approach for identifying critical residues involved in ligand binding and signal transduction. By systematically altering specific amino acids within the transmembrane domains or predicted binding pocket of Olfr180, researchers can assess the impact on ligand specificity and receptor activation. Mutations should target conserved motifs as well as variable regions that might contribute to the unique response profile of Olfr180 compared to other receptors.

Comparative studies with related olfactory receptors that have overlapping but distinct molecular receptive ranges, such as MOR23-1, MOR31-4, MOR32-11, and MOR40-4, can provide valuable insights into the structural determinants of ligand specificity . Chimeric receptor constructs, in which portions of Olfr180 are swapped with corresponding regions from receptors with different response profiles, can help identify domains responsible for specific functional properties. Additionally, computational modeling and molecular dynamics simulations based on the Olfr180 sequence can predict ligand-receptor interactions and guide experimental design. These in silico approaches are particularly valuable given the challenges associated with obtaining crystal structures of membrane proteins like olfactory receptors.

For functional assessment of the modified receptors, the same methodologies used to characterize wild-type Olfr180—such as electrophysiological recording in Xenopus oocytes or calcium imaging in mammalian cells—can be employed to quantify changes in response properties resulting from structural modifications .

What are the most promising approaches for incorporating Olfr180 into biosensor applications?

Olfactory receptors like Olfr180 offer unique capabilities for the development of highly sensitive and selective biosensors for detecting specific volatile compounds. Several promising approaches exist for incorporating Olfr180 into functional biosensor platforms. Cell-based biosensors represent one strategy, where cells expressing Olfr180 are coupled to detection systems that measure receptor activation, such as calcium-sensitive fluorescent proteins or luciferase reporters. These cellular biosensors can be miniaturized and incorporated into microfluidic devices for portable detection applications.

For greater stability and longer shelf-life, cell-free biosensor platforms utilizing purified recombinant Olfr180 represent an attractive alternative. The receptor can be incorporated into artificial lipid bilayers, nanodiscs, or polymer membranes coupled to transducer elements that convert receptor activation into measurable signals. These might include electrical (impedance changes), optical (fluorescence or surface plasmon resonance), or mechanical (quartz crystal microbalance) transduction mechanisms. The His-tagged recombinant Olfr180 can be oriented on metal surfaces or nanoparticles through the affinity tag, ensuring proper presentation of the ligand-binding domain .

To enhance stability and functionality in these cell-free systems, Olfr180 can be modified through protein engineering approaches, such as directed evolution or computational design, to improve properties like thermostability, pH tolerance, and detergent compatibility. The detection sensitivity and specificity of Olfr180-based biosensors should be carefully characterized using a panel of potential ligands, with particular attention to compounds structurally related to carboxylic acids with 7-10 carbon chains, which have been identified as activators of similar olfactory receptors .

How might comparative studies between Olfr180 and other olfactory receptors advance our understanding of olfactory coding?

Comparative studies of Olfr180 and other olfactory receptors offer valuable insights into the principles of olfactory coding and the evolution of chemosensory systems. Research has demonstrated that even relatively unrelated receptors can have extensive overlap in their molecular receptive ranges while maintaining unique response profiles . This property contributes to the combinatorial coding strategy employed by the olfactory system, where distinct patterns of receptor activation encode odor identity. By systematically comparing the response properties of Olfr180 to those of other receptors (e.g., MOR23-1, MOR31-4, MOR32-11, and MOR40-4), researchers can map overlapping and distinct regions of "odor space" covered by each receptor .

Sequence analysis and homology modeling can reveal conserved and variable regions across olfactory receptors, potentially identifying structural motifs associated with particular ligand preferences. For example, comparing Olfr180 with Class I and Class II olfactory receptors might uncover evolutionary adaptations related to detecting different chemical classes of odorants . Systematic analysis of receptor sequences in conjunction with functional data can be compiled into a comprehensive database that correlates specific sequence features with response properties.

Transcriptomic analysis across different olfactory tissues can further illuminate how Olfr180 expression levels compare to other receptors and whether co-expression patterns exist that might suggest functional groupings . The discovery of olfactory receptor expression in non-olfactory tissues, such as the eye, raises intriguing questions about potential chemosensory functions beyond canonical olfaction . Investigating whether Olfr180 is expressed in these alternative tissues could provide new insights into its broader physiological roles and the evolution of chemosensory signaling pathways across different organ systems.

What are common challenges in expressing and purifying recombinant Olfr180 and how can they be addressed?

Expressing and purifying recombinant olfactory receptors like Olfr180 presents several technical challenges due to their hydrophobic nature and multiple transmembrane domains. One common issue is low expression yield in heterologous systems. This can be addressed through optimization of codon usage for the expression host, incorporation of fusion tags that enhance expression and folding, and careful selection of expression conditions. For E. coli expression systems, using specialized strains designed for membrane protein expression (e.g., C41(DE3), C43(DE3)) and lowering induction temperature (16-20°C) can significantly improve functional protein yield .

Protein aggregation during extraction and purification represents another significant challenge. This can be mitigated by screening multiple detergents or detergent mixtures to identify optimal solubilization conditions that maintain protein stability and native conformation. Detergents such as n-dodecyl-β-D-maltoside (DDM), lauryl maltose neopentyl glycol (LMNG), or digitonin have proven effective for other GPCRs and may be suitable for Olfr180. Additionally, the inclusion of cholesterol or cholesterol analogs in purification buffers can enhance stability of the receptor.

For storage and reconstitution issues, careful optimization of buffer components is essential. The reported Tris/PBS-based buffer containing 6% trehalose at pH 8.0 has been specifically developed for recombinant Olfr180 . Trehalose serves as a stabilizing agent that helps maintain protein structure during lyophilization and reconstitution. When reconstituting lyophilized Olfr180, a gradual dilution approach rather than direct addition of the full volume can help minimize aggregation. For long-term storage, aliquoting the protein in small volumes with 50% glycerol and storing at -80°C minimizes degradation from repeated freeze-thaw cycles .

How can researchers validate the functional integrity of recombinant Olfr180 after purification?

Validating the functional integrity of purified recombinant Olfr180 is crucial for ensuring reliable experimental results. Several complementary approaches can be employed to assess both structural integrity and functional activity. For structural validation, circular dichroism (CD) spectroscopy provides valuable information about secondary structure content, particularly the alpha-helical composition characteristic of GPCRs with seven transmembrane domains. Thermal stability assays, such as differential scanning fluorimetry, can assess the protein's conformational stability under various conditions and in the presence of potential ligands, with increased thermal stability often indicating ligand binding.

Ligand binding assays represent a direct approach to confirming functional integrity. These might include fluorescence-based assays using fluorescent ligands or competitive binding assays with radiolabeled compounds. For Olfr180, initial screening should include carboxylic acids with 7-10 carbon chains, based on the ligand preferences of similar olfactory receptors . Reconstitution into artificial membrane systems, such as proteoliposomes or nanodiscs, followed by functional assays can provide evidence of activity in a membrane environment that more closely resembles the native receptor context.

For more comprehensive functional validation, the purified receptor can be reconstituted into systems that allow measurement of G-protein coupling efficiency. These might include GTPγS binding assays or bioluminescence resonance energy transfer (BRET) approaches that detect conformational changes associated with receptor activation. When possible, comparing the properties of recombinant Olfr180 with the receptor expressed in a more native-like context, such as heterologous mammalian expression systems or isolated olfactory neurons, provides valuable benchmarks for assessing functional integrity.

What strategies can improve the reproducibility of Olfr180-related experiments across different laboratories?

Ensuring reproducibility in Olfr180 research requires standardization of key experimental parameters and thorough documentation of methodologies. Standardized expression constructs represent a fundamental starting point—these should include the complete coding sequence with consistent fusion tags and regulatory elements. The "rhodopsin tag" approach (adding the N-terminal 20 amino acids of human rhodopsin) has proven effective for enhancing surface expression of olfactory receptors and could be adopted as a standard for Olfr180 expression studies .

Detailed reporting of experimental conditions is essential for reproducibility. For PCR-based detection methods, this includes precise documentation of primer sequences, cycling conditions, and controls used . The following table outlines critical parameters that should be reported for common experimental approaches:

The development and sharing of reference standards would significantly enhance cross-laboratory reproducibility. These might include stable cell lines expressing Olfr180, purified receptor protein batches with verified activity, or synthetic peptides corresponding to extracellular domains for antibody validation. Collaborative ring trials, in which multiple laboratories perform standardized protocols with the same materials, can identify sources of variability and establish robust methodologies.

Publication of detailed protocols in repositories such as Bio-protocol or Protocol Exchange, including troubleshooting guides and expected outcomes, provides valuable resources for new researchers entering the field. Finally, sharing of raw data through public databases ensures transparency and allows reanalysis as new analytical methods emerge, further enhancing the reproducibility and impact of Olfr180 research.

What emerging technologies might advance our understanding of Olfr180 function and signaling?

Several cutting-edge technologies hold promise for deepening our understanding of Olfr180 function and signaling pathways. Cryo-electron microscopy (cryo-EM) represents a transformative approach for elucidating the three-dimensional structure of membrane proteins like olfactory receptors. While traditional crystallography has proven challenging for GPCRs due to their flexibility and hydrophobicity, advances in cryo-EM have enabled structural determination of previously intractable membrane proteins. Application of this technology to purified Olfr180, particularly in complex with signaling partners or ligands, could provide unprecedented insights into the structural basis of receptor function.

CRISPR-Cas9 genome editing offers powerful capabilities for investigating Olfr180 in its native context. This technology enables precise modification of the endogenous Olfr180 gene to introduce reporter tags, conditional expression systems, or specific mutations. Such genetic modifications in model organisms would allow visualization of Olfr180-expressing cells, temporal control of receptor expression, and evaluation of how specific sequence alterations affect receptor function in vivo. Additionally, single-cell transcriptomics provides a comprehensive view of the gene expression landscape in individual olfactory sensory neurons expressing Olfr180, potentially revealing co-expressed factors that influence receptor function or downstream signaling.

Optogenetic and chemogenetic approaches provide exciting opportunities for manipulating Olfr180-expressing neurons with temporal and spatial precision. By introducing light-sensitive or designer drug-sensitive proteins into Olfr180-expressing cells, researchers can selectively activate or inhibit these neurons and assess the resulting physiological and behavioral effects. This would help establish the specific contribution of Olfr180 to odor perception and discrimination within the complex olfactory network. Integration of these technologies with computational modeling and systems biology approaches will ultimately lead to a more comprehensive understanding of how Olfr180 contributes to olfactory coding and sensory perception.

How might studies of Olfr180 inform our understanding of ectopic olfactory receptor expression in non-olfactory tissues?

Recent discoveries of olfactory receptor expression in non-olfactory tissues have expanded our understanding of these receptors beyond their canonical roles in odor perception. Research has demonstrated expression of olfactory signaling genes, including olfactory receptors, G proteins (Gαolf), and olfactory marker protein (OMP) in ocular tissues such as the corneal epithelium, suggesting potential chemosensory functions in the eye . Investigation of Olfr180 expression in these and other non-olfactory tissues could reveal novel physiological roles for this receptor beyond the olfactory system.

The methodological approaches used to detect and characterize olfactory receptors in non-olfactory contexts provide a valuable framework for studying Olfr180 in these settings. These include RNA sequencing to identify transcript expression, RT-PCR with intron-spanning primers to confirm expression at the mRNA level, and in situ hybridization to localize expression to specific cell types . The RNAscope technology, which offers high sensitivity and specificity for mRNA detection in tissue sections, represents a particularly valuable approach for visualizing Olfr180 expression in non-olfactory tissues .

Functional studies in these non-canonical contexts could illuminate how Olfr180 might contribute to tissue-specific chemosensory functions. For instance, if Olfr180 is expressed in blood vessels, as has been observed for some olfactory receptors in the eye (e.g., Olfr558 in arterioles) , it might participate in sensing blood-borne metabolites or regulating vascular tone. Comparative studies examining the promoter architecture and transcriptional regulation of Olfr180 in olfactory versus non-olfactory tissues could reveal tissue-specific regulatory mechanisms and provide insights into the evolutionary co-option of olfactory receptors for diverse physiological functions beyond their original role in odor detection.

What potential applications exist for Olfr180 in biomedical research and therapeutic development?

Olfactory receptors like Olfr180 offer intriguing possibilities for biomedical applications beyond their traditional role in olfaction. As highly selective chemosensors, these receptors could serve as the basis for diagnostic tools capable of detecting specific biomarkers in patient samples. For instance, if Olfr180 responds to metabolites associated with particular disease states, receptor-based biosensors could provide rapid, sensitive detection methods. Such applications would leverage the recombinant expression and purification methods developed for Olfr180 , incorporating the receptor into appropriate biosensing platforms.

In drug discovery, Olfr180 and other olfactory receptors represent potential novel therapeutic targets, particularly if their expression in non-olfactory tissues contributes to pathophysiological processes. The detailed molecular characterization of Olfr180, including its ligand specificity and signaling pathways, would facilitate the development of compounds that selectively modulate its activity. Structure-based drug design approaches, informed by comparative studies with related receptors like MOR23-1, MOR31-4, MOR32-11, and MOR40-4 , could accelerate the identification of such modulators.

Additionally, understanding the promoter architecture and transcriptional regulation of Olfr180 could inform the development of gene therapy approaches targeting olfactory sensory neurons or other cells expressing this receptor. The extensive knowledge of OR promoter regions, including the identification of transcription factors like TBP, EBF1 (OLF1), and MEF2A that bind to OR promoters , provides valuable insights for designing expression constructs with appropriate tissue specificity. As research continues to unveil the diverse functions of olfactory receptors throughout the body, Olfr180 may emerge as an important target for innovative therapeutic strategies addressing conditions ranging from sensory disorders to systemic diseases involving chemosensory signaling pathways.