Recombinant Mouse Oligosaccharyltransferase complex subunit OSTC (Ostc)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. Please specify your desired tag type for preferential development.
Synonyms
Ostc; Oligosaccharyltransferase complex subunit OSTC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-149
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Ostc
Target Protein Sequence
METLYRVPFLVLECPNLKLKKPPWVHMPSAMTVYALVVVSYFLITGGIIYDVIVEPPSVG SMTDEHGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIILDRSNAPNIPKLNRFLL LFIGFVCVLLSFFMARVFMRMKLPGYLMG
Uniprot No.

Target Background

Function
Recombinant Mouse Oligosaccharyltransferase complex subunit OSTC (Ostc) is a subunit of the oligosaccharyltransferase (OST) complex. This complex catalyzes the transfer of a defined glycan (Glc3Man9GlcNAc2 in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. This is the initial step in protein N-glycosylation, a cotranslational process. The OST complex associates with the Sec61 complex at the translocon, facilitating protein translocation across the endoplasmic reticulum (ER). All subunits are essential for optimal enzyme activity. OSTC may be involved in N-glycosylation of amyloid-beta precursor protein (APP) and modulate gamma-secretase cleavage of APP by enhancing PSEN1 endoproteolysis.
Gene References Into Functions
  1. This study suggests that upregulation of OSTC/DC2, a novel component of the oligosaccharyltransferase complex, is part of the mammalian heat shock response. PMID: 24751383
Database Links
Protein Families
OSTC family
Subcellular Location
Endoplasmic reticulum. Membrane; Multi-pass membrane protein.

Q&A

What is the function of Oligosaccharyltransferase complex subunit OSTC and why is it important in research?

Oligosaccharyltransferase complex subunit OSTC (Ostc) functions as a critical component of the oligosaccharyltransferase (OST) complex, which catalyzes the transfer of high-mannose oligosaccharides to asparagine residues in nascent polypeptide chains. This N-linked glycosylation process is essential for proper protein folding, stability, and function in the endoplasmic reticulum. Research using recombinant OSTC helps elucidate the mechanisms of N-glycosylation in various physiological and pathological contexts, particularly in mouse models of human diseases. Understanding OSTC's role can provide insights into glycosylation disorders and potential therapeutic targets for conditions involving protein misfolding.

What expression systems are commonly used for producing Recombinant Mouse OSTC?

Recombinant Mouse OSTC is typically produced using either prokaryotic (E. coli) or eukaryotic expression systems (mammalian cells, insect cells, or yeast). Each system offers distinct advantages: E. coli systems provide high yield and cost-effectiveness but lack post-translational modifications, while mammalian expression systems more closely mimic the native protein structure and modifications. For studies requiring functional analysis of OSTC, mammalian expression systems are generally preferred despite their higher cost and complexity. Similarly to other recombinant proteins, expression vectors containing a C-terminal or N-terminal affinity tag (such as 6-His tag) are commonly employed to facilitate purification .

What are the recommended storage conditions for maintaining OSTC stability?

Recombinant Mouse OSTC stability depends on proper storage conditions. The lyophilized form can be stored at -20°C for extended periods, while reconstituted protein requires more careful handling. Based on standard practices for similar recombinant proteins, OSTC should be reconstituted in an appropriate buffer (typically PBS) and stored at concentrations around 250 μg/mL. To prevent protein degradation and maintain activity, it is advisable to use a manual defrost freezer and avoid repeated freeze-thaw cycles. For short-term usage (1-2 weeks), storing aliquots at 4°C is acceptable, but for long-term storage, -80°C is recommended with the addition of glycerol (10-50%) or carrier proteins if using the non-carrier-free version .

How should researchers validate the identity and purity of commercially obtained OSTC?

Researchers should employ multiple analytical techniques to validate commercially obtained OSTC. SDS-PAGE can confirm the molecular weight (approximately 11 kDa for the core protein), while Western blotting using anti-OSTC antibodies verifies identity. Mass spectrometry provides definitive confirmation of both molecular weight and sequence. Purity assessment should include densitometric analysis of SDS-PAGE gels (aiming for >95% purity) and size-exclusion chromatography to detect aggregates or degradation products. Additionally, researchers should review the certificate of analysis provided by suppliers, which typically includes information about expression systems, purification methods, and quality control tests. Functional validation through binding assays or enzymatic activity tests specific to OSTC's role in the OST complex provides ultimate confirmation of biological activity.

How does the structural integrity of Recombinant Mouse OSTC compare to native OSTC?

The structural integrity comparison between recombinant and native OSTC requires sophisticated analytical techniques. Circular dichroism spectroscopy can evaluate secondary structure elements, while nuclear magnetic resonance (NMR) spectroscopy provides atomic-level insights into tertiary structure. X-ray crystallography, although challenging with membrane-associated proteins like OSTC, offers the highest resolution structural information when successful. Recombinant OSTC, especially when expressed in E. coli, may lack post-translational modifications present in native OSTC, potentially affecting folding and activity. Researchers should consider these structural differences when interpreting experimental results, particularly in studies examining protein-protein interactions or enzymatic functions. Functional assays measuring glycosylation activity provide complementary evidence of proper folding and biological relevance.

What methodological approaches are most effective for studying OSTC interactions with other components of the OST complex?

Studying OSTC interactions requires multi-faceted approaches. Co-immunoprecipitation assays using antibodies against OSTC or potential binding partners can identify protein-protein interactions in cell lysates. For more quantitative measurements, surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) provides binding kinetics and thermodynamic parameters. Proximity-based techniques such as fluorescence resonance energy transfer (FRET) or bioluminescence resonance energy transfer (BRET) enable the visualization of protein interactions in living cells. Structural studies combining crosslinking mass spectrometry with computational modeling help map interaction interfaces. Mammalian two-hybrid or split-luciferase complementation assays offer alternative approaches for confirming direct interactions. When designing these experiments, researchers should include appropriate controls, including interaction-deficient mutants and competition assays with unlabeled proteins to confirm specificity.

What are the considerations for using CRISPR/Cas9 to study OSTC function in cellular models?

CRISPR/Cas9-mediated gene editing offers powerful approaches for studying OSTC function, but requires careful experimental design. Guide RNA design should target conserved regions of the OSTC gene while avoiding off-target effects, which can be predicted using algorithms like Cas-OFFinder. Complete knockout of OSTC may be lethal due to its essential role in N-glycosylation, making conditional knockout systems or hypomorphic alleles more appropriate. For precise genetic modifications, homology-directed repair templates should include silent mutations in the PAM site or gRNA binding region to prevent re-cutting. Validation of edited cells must include genomic sequencing, western blotting, and functional assays to confirm the expected glycosylation defects. Researchers should also consider compensatory mechanisms that might mask phenotypes, particularly upregulation of related OST complex components, necessitating careful interpretation of negative results.

How can researchers distinguish between direct effects of OSTC manipulation and secondary effects due to altered global glycosylation?

Distinguishing direct from secondary effects requires sophisticated experimental designs. Rescue experiments using wild-type versus mutant OSTC can help establish causality, particularly mutations that affect specific protein interactions while maintaining core glycosylation functions. Temporal analysis using inducible expression or degradation systems helps separate immediate from long-term adaptation effects. Comparative glycoproteomics between control and OSTC-manipulated samples can identify specifically affected glycoproteins versus global changes. Targeted analysis of known glycosylation sites on selected proteins using site-specific glycopeptide enrichment and mass spectrometry provides higher resolution data. Domain-swapping experiments with other OST subunits can help map function-specific regions of OSTC. Researchers should always include appropriate controls and consider time-dependent changes in their experimental designs to avoid misattributing secondary adaptations to primary OSTC functions.

What is the recommended protocol for reconstituting lyophilized Recombinant Mouse OSTC?

For optimal reconstitution of lyophilized Recombinant Mouse OSTC, researchers should first allow the vial to reach room temperature. Under aseptic conditions, add sterile PBS to achieve a final concentration of 250 μg/mL, as recommended for similar recombinant proteins . Gently rotate the vial to ensure complete dissolution without introducing air bubbles or vigorous shaking that could cause protein denaturation. Allow the solution to stand for 10-15 minutes at room temperature before confirming complete reconstitution visually (solution should be clear or slightly opalescent). For experimental applications requiring different buffers, consider using a desalting column to exchange buffers rather than direct reconstitution in alternative solutions. The reconstituted protein should be aliquoted to avoid repeated freeze-thaw cycles and stored according to the conditions described in section 1.3. Before experimental use, centrifuge the solution briefly to remove any particulates and validate protein concentration using spectrophotometric measurement or protein assay.

How should researchers design control experiments when studying OSTC function?

Robust control design is essential for OSTC functional studies. Negative controls should include inactive OSTC mutants (with point mutations in catalytic or binding domains) and unrelated proteins of similar size and purification history. Positive controls might include native OST complex preparations or well-characterized recombinant OSTC from previous studies. For cellular experiments, include vector-only transfections, CRISPR non-targeting controls, and rescue experiments with wild-type OSTC. Concentration-matched BSA controls help distinguish carrier effects from specific OSTC activity. The experimental design should include dose-response relationships to establish specificity and reduce the risk of artifacts from supraphysiological concentrations. Temporal controls are also important, as glycosylation effects may manifest with different kinetics than direct OSTC interactions. Finally, different cell lines or tissue types should be tested when possible to ensure findings are not cell-type specific.

What analytical methods best characterize the purity and activity of Recombinant Mouse OSTC?

Comprehensive characterization requires complementary analytical techniques. Protein purity is best assessed through:

Analytical TechniqueInformation ProvidedTypical Acceptance Criteria
SDS-PAGE (Coomassie)Visual purity assessment>95% single band
Silver stainingDetection of trace contaminantsNo significant impurities
Western blottingIdentity confirmationSingle specific band
SEC-HPLCAggregation and fragmentation>90% monomeric protein
Mass spectrometryAccurate mass and modificationsWithin 0.1% of theoretical mass

For functional characterization, binding assays using surface plasmon resonance or bio-layer interferometry can quantify interactions with other OST complex components. Enzymatic assays measuring glycosylation of model peptide substrates provide direct activity measurements. Thermal shift assays assess protein stability and can screen for optimal buffer conditions. Circular dichroism spectroscopy confirms proper secondary structure. These analytical methods collectively provide a comprehensive profile of OSTC quality and fitness for specific research applications.

How can Recombinant Mouse OSTC be effectively used in structural biology studies?

Structural biology applications require specific considerations for OSTC. For X-ray crystallography, high-purity (>99%) carrier-free OSTC preparations are essential, as heterogeneity hinders crystal formation . Crystallization screening should explore a wide range of conditions, with special attention to detergents that maintain OSTC in a soluble, monodisperse state. For cryo-electron microscopy (cryo-EM), OSTC can be studied in the context of the entire OST complex, providing insights into its structural arrangement and interactions. Sample preparation strategies include gradient fixation (GraFix) to stabilize complexes and the use of specialized grids to prevent preferred orientation issues. NMR studies typically require isotopically labeled OSTC (15N, 13C), necessitating expression in minimal media with labeled precursors. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) offers an alternative approach for mapping interaction surfaces and conformational changes without requiring crystals. Computational approaches, including molecular dynamics simulations and homology modeling, can complement experimental data, especially when high-resolution structures prove challenging to obtain.

How should researchers approach comparative studies between mouse OSTC and human OSTC?

Comparative studies between species require careful experimental design. Sequence alignment analysis should first identify conserved and divergent regions between mouse and human OSTC, focusing experimental comparisons on these specific domains. Expression conditions should be standardized to minimize system-dependent variations when comparing recombinant proteins. Cross-species complementation experiments, where human OSTC is expressed in mouse OSTC-deficient cells (or vice versa), can reveal functional conservation or specialization. Binding kinetics comparisons using identical assay conditions provide quantitative measures of potentially different interaction properties. For structural comparisons, both proteins should be produced with identical tags and purification strategies to minimize method-induced differences. When interpreting differences, researchers should consider evolutionary context and physiological specializations between species. The translational relevance of findings in mouse models to human biology should be explicitly addressed, acknowledging both the value and limitations of cross-species extrapolation.

What are the most reliable positive controls for validating OSTC activity in biochemical assays?

Reliable positive controls are critical for validating OSTC activity in biochemical assays. For binding assays, commercially available recombinant OST complex components with documented interaction capacity serve as reliable controls. Native OST complex isolated from mouse tissues provides a gold standard for activity assays, although isolation procedures are technically challenging. When studying glycosylation function, well-characterized glycosyltransferases with established activity on defined substrates offer complementary positive controls. Reference standards of known concentration and activity, ideally from previous lots of the same recombinant OSTC preparation, enable inter-experimental normalization. For cell-based assays, cells overexpressing wild-type OSTC provide appropriate positive controls. Importantly, positive controls should undergo the same handling, storage, and experimental conditions as the test samples to ensure valid comparisons. Researchers should maintain detailed records of positive control performance across experiments to identify any drift in assay sensitivity or reliability over time.

How can researchers address poor solubility or aggregation of Recombinant Mouse OSTC?

Poor solubility and aggregation of Recombinant Mouse OSTC can significantly compromise experimental outcomes. To address these issues, researchers should first optimize buffer composition, testing various pH conditions (typically pH 6.5-8.0), salt concentrations (100-500 mM NaCl), and stabilizing additives like glycerol (5-20%). For this membrane-associated protein, mild detergents (0.01-0.05% DDM, CHAPS, or Triton X-100) may be essential for maintaining solubility without disrupting native conformation. Protein concentration should be carefully controlled, as higher concentrations promote aggregation; working at 0.1-0.5 mg/mL may prevent self-association. Addition of reducing agents (1-5 mM DTT or TCEP) can prevent disulfide-mediated aggregation if cysteine residues are present. Physical handling also matters—gentle mixing rather than vortexing, filtration rather than centrifugation for clarification, and temperature control during manipulation (4°C typically preferred) can all reduce aggregation. If aggregation persists, refolding approaches using chaotropic agents with gradual dilution might recover functional protein from inclusion bodies.

What strategies can overcome inconsistent results in OSTC functional assays?

Inconsistent functional assay results often stem from multiple factors. Standardization is key—establish detailed protocols specifying protein concentration, buffer composition, incubation times, temperature, and detection methods. Batch-to-batch variability in recombinant OSTC can be addressed by characterizing each preparation using analytical techniques described in section 3.4 and normalizing experimental inputs accordingly. Internal calibration controls should be included in every assay to enable cross-experiment normalization. For cell-based assays, controlling cell density, passage number, and transfection efficiency reduces variability. Environmental factors including temperature fluctuations, light exposure, and microplate positional effects should be minimized through experimental design. Statistical approaches including technical replicates (minimum triplicates) and appropriate statistical tests help distinguish biological variation from technical noise. When inconsistency persists, systematic variation of experimental parameters in factorial designs can identify sensitive variables driving variability, which can then be more tightly controlled in subsequent experiments.

How should researchers interpret conflicting data between different experimental systems studying OSTC function?

Interpreting conflicting data requires systematic analysis of differences between experimental systems. First, evaluate the biological complexity of each system—purified recombinant proteins may behave differently from cellular contexts where interacting partners are present. Expression systems influence post-translational modifications and folding, potentially explaining functional differences between E. coli-derived versus mammalian cell-derived OSTC. For cell-based systems, consider cell type-specific factors including endogenous OST complex composition and glycosylation machinery. Methodological differences including buffer conditions, detection methods, and kinetic versus endpoint measurements can produce apparently conflicting results despite consistent underlying biology. When conflicts persist, orthogonal approaches testing the same hypothesis through independent methods provide the strongest resolution. Creating a comprehensive comparison table highlighting all experimental variables between conflicting studies can identify critical differences explaining discrepancies. Finally, biological redundancy or compensatory mechanisms may mask phenotypes in more complex systems, explaining differences between reductionist and physiological approaches.

What statistical approaches are appropriate for analyzing dose-response data with Recombinant Mouse OSTC?

Appropriate statistical analysis of dose-response data ensures robust interpretation of OSTC activity. Non-linear regression modeling using four-parameter logistic equations typically provides the best fit for biological response curves, yielding parameters including EC50 (or IC50), maximum effect, minimum effect, and Hill slope. For comparing potency across conditions, confidence intervals around EC50 values offer more information than simple point estimates. Outlier detection and handling should follow pre-established criteria, such as the ROUT method with Q=1%. For experiments with multiple variables (e.g., different cell types or readouts), two-way ANOVA with appropriate post-hoc tests examines interaction effects. Normalization approaches should be carefully considered—percent of maximum response facilitates comparisons but can mask absolute magnitude differences. Presentation should include both curve-fitting and raw data points to enable visual assessment of fit quality. Statistical software documentation and all transformation steps should be reported for reproducibility. For complex datasets, consulting with a biostatistician during experimental design, not just analysis, maximizes statistical power and interpretability.

What are the essential elements to include when reporting OSTC experimental methods in publications?

Comprehensive methods reporting enables reproducibility of OSTC research. Essential elements include:

  • Protein specifications: Source, catalog number for commercial OSTC, expression system, purification method, tag type/position, and whether carrier-free or carrier-containing preparation was used

  • Quality control: Purity percentage, methods used to assess purity/identity, and activity validation approach

  • Storage and handling: Reconstitution protocol, storage conditions, and maximum storage time/freeze-thaw cycles before use

  • Experimental conditions: Complete buffer composition, pH, temperature, incubation times, protein concentration, and surface/container materials

  • Controls: Detailed description of positive and negative controls, including sourcing and preparation

  • Detection methods: Instrumentation models, detection limits, calibration procedures, and analysis software with version numbers

  • Data processing: All normalization steps, statistical tests with justification, outlier criteria, and software packages used

  • Replication: Number of independent experiments versus technical replicates, and how biological variability was addressed

This comprehensive reporting facilitates both reproducibility and meta-analysis across studies.

How should researchers prepare publication-quality figures demonstrating OSTC activity or interactions?

Publication-quality figures should effectively communicate OSTC findings while maintaining scientific integrity. Data visualization should follow field standards—using line graphs for kinetic or dose-response data, bar graphs for comparative single-point measurements, and scatter plots overlaid on bars to show data distribution. Representative images of blots, gels, or microscopy should include size markers, scale bars, and appropriate controls on the same image. Multi-panel figures should follow a logical flow with consistent formatting across panels. Color choices should remain distinguishable when printed in grayscale and be accessible to colorblind readers (avoid red/green combinations). Statistical significance indicators should be clearly defined in legends, including test type, sample size, and actual p-values rather than significance brackets alone. For binding or interaction data, both processed (curve fits) and raw data points should be displayed. Figure legends must be comprehensive enough to understand the figure without referring to the main text. Software used for figure preparation should be reported, and original unprocessed images should be available for reviewer examination or supplementary material.

What considerations are important when comparing OSTC research findings across different studies?

Meaningful cross-study comparisons require careful consideration of experimental variables. Protein source and preparation differences may explain functional variations—E. coli-expressed OSTC lacks mammalian post-translational modifications present in HEK293-expressed protein. Buffer composition affects stability and activity, particularly ionic strength, pH, and detergent type/concentration for this membrane-associated protein. Experimental readouts may measure different aspects of OSTC function (binding versus catalytic activity), complicating direct comparisons. Species differences between mouse and human OSTC should be explicitly acknowledged when comparing across organisms. Temporal factors matter—acute versus chronic manipulations often yield different phenotypes due to compensatory mechanisms. Quantitative comparisons require standardization to common units and normalization methods. When synthesizing findings across studies, researchers should create comparison tables highlighting methodological differences and utilize forest plots for quantitative outcomes with compatible measures. Systematic reviews with clear inclusion criteria provide the strongest framework for integrating diverse OSTC literature while acknowledging limitations in cross-study comparability.

What emerging technologies offer new approaches for studying OSTC function?

Emerging technologies are expanding opportunities for OSTC research. Cryo-electron tomography enables visualization of OST complexes in their native membrane environment, providing unprecedented structural insights into OSTC's arrangement and dynamics. Proximity labeling approaches (BioID, APEX) can map the OSTC interactome in living cells with temporal and spatial resolution. Single-molecule techniques including FRET and optical tweezers allow real-time observation of OSTC conformational changes during substrate binding and catalysis. CRISPR base editing and prime editing enable precise genetic modifications without complete gene disruption, permitting subtle alterations to specific OSTC domains. Advanced glycoproteomics using machine learning algorithms can identify glycosylation patterns associated with OSTC variants across the proteome. Organoid and organ-on-chip technologies provide physiologically relevant systems for studying OSTC function in tissue-specific contexts. Computational approaches including AlphaFold2 structural predictions and molecular dynamics simulations complement experimental data by generating testable hypotheses about structure-function relationships in OSTC. Collectively, these technologies enable more mechanistic understanding of OSTC's role in the glycosylation machinery.

What are the most significant unanswered questions about OSTC function?

Despite progress in glycobiology research, significant questions about OSTC remain unanswered. The precise molecular mechanism by which OSTC contributes to oligosaccharyltransferase activity—whether structural, regulatory, or directly catalytic—remains unclear. The substrate specificity determinants influenced by OSTC within the OST complex are poorly understood, particularly how OSTC might affect selection of glycosylation sites or glycan structures. Tissue-specific roles of OSTC are largely unexplored, including whether alternative splicing generates functional variants with specialized activities. The regulatory mechanisms controlling OSTC expression, localization, and activity under normal and stress conditions remain to be elucidated. Potential moonlighting functions beyond glycosylation, including possible roles in protein quality control or signal transduction, warrant investigation. The contribution of OSTC dysfunction to disease states, particularly those involving protein misfolding or ER stress, represents an important translational research direction. Evolutionary analyses suggest functional specialization of OSTC across species, but the physiological significance of these differences remains speculative. Addressing these questions will require integrative approaches combining structural biology, biochemistry, and cellular physiology.

How might understanding OSTC function contribute to therapeutic approaches for glycosylation disorders?

Understanding OSTC function has significant therapeutic implications for glycosylation disorders. Detailed characterization of OSTC's contribution to the OST complex could identify druggable pockets for small molecules that modulate glycosylation activity, potentially addressing hypoglycosylation in congenital disorders of glycosylation (CDGs). Structure-based drug design targeting OSTC-substrate interactions might enable selective modulation of specific glycosylation events while preserving others. Gene therapy approaches delivering engineered OSTC variants could compensate for loss-of-function mutations causing glycosylation defects. For disorders involving misfolded glycoproteins, manipulating OSTC activity might enhance correct folding by optimizing glycosylation timing or site occupancy. Chemical chaperones stabilizing OSTC folding could address mutations causing its premature degradation. Understanding tissue-specific roles of OSTC may enable targeted interventions for organ-specific glycosylation disorders. The development of biomarkers based on OSTC-dependent glycosylation patterns could improve diagnosis and treatment monitoring. While direct OSTC-targeted therapeutics remain theoretical, the foundational knowledge gained from basic research is essential for developing rational approaches to correcting glycosylation defects in human disease.

What interdisciplinary approaches might yield new insights into OSTC biology?

Interdisciplinary approaches offer promising avenues for advancing OSTC research. Combining structural biology with computational chemistry can identify allosteric sites and predict effects of small-molecule modulators on OSTC function. Systems biology approaches integrating transcriptomics, proteomics, and glycomics data can map how OSTC perturbations propagate through cellular networks, revealing unexpected connections to other biological processes. Bioengineering techniques including directed evolution and protein design may generate OSTC variants with enhanced stability or altered substrate specificity for biotechnological applications. Chemical biology approaches developing activity-based probes for OSTC could enable spatiotemporal tracking of its function in living systems. Collaboration with clinical researchers studying glycosylation disorders would connect basic OSTC biology to human pathophysiology, while developmental biologists could elucidate its role in organismal growth and differentiation. Physics-based approaches including optical tweezers or atomic force microscopy could measure mechanical properties of OSTC-substrate interactions. Mathematical modeling of the glycosylation pathway incorporating OSTC parameters would enable prediction of system-level responses to perturbations. These diverse approaches, when integrated, promise deeper understanding of OSTC's multifaceted biological roles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.